AWS Remote Jobs

1192 Results

13d

Senior Data Engineer

InvocaRemote
Bachelor's degreesqlsalesforceDesignswiftazureapic++postgresqlmysqlpythonAWS

Invoca is hiring a Remote Senior Data Engineer

About Invoca:

Invoca is the industry leader and innovator in AI and machine learning-powered Conversation Intelligence. With over 300 employees, 2,000+ customers, and $100M in revenue, there are tremendous opportunities to continue growing the business. We are building a world-class SaaS company and have raised over $184M from leading venture capitalists including Upfront Ventures, Accel, Silver Lake Waterman, H.I.G. Growth Partners, and Salesforce Ventures.

About the Engineering Team:

You’ll join a team where everyone, including you, is striving to constantly improve their knowledge of software development tools, practices, and processes. We are an incredibly supportive team. We swarm when problems arise and give excellent feedback to help each other grow. Working on our close-knit, multi-functional teams is a chance to share and grow your knowledge of different domains from databases to front ends to telephony and everything in between.

We are passionate about many things: continuous improvement, working at a brisk but sustainable pace, writing resilient code, maintaining production reliability, paying down technical debt, hiring fantastic teammates; and we love to share these passions with each other.

Learn more about the Invoca development team on our blog and check out our open source projects.

You Will:

Invoca offers a unique opportunity to make massive contributions to machine learning and data science as it applies to conversation intelligence, marketing, sales and user experience optimization.

You are excited about this opportunity because you get to:

  • Design and develop highly performant and scalable data storage solutions
  • Extend and enhance the architecture of Invoca’s data infrastructure and pipelines
  • Deploy and fine-tune machine learning models within an API-driven environment, ensuring scalability, efficiency, and optimal performance.
  • Expand and optimize our Extract, Transform, and Load (ETL) processes to include various structured and unstructured data sources within the Invoca Platform.
  • Evaluate and implement new technologies as needed and work with technical leadership to drive adoption.
  • Collaborate with data scientists, engineering teams, analysts, and other stakeholders to understand data requirements and deliver solutions on behalf of our customers
  • Support diversity, equity and inclusion at Invoca

At Invoca, our Senior Data Engineers benefit from mentorship provided by experts spanning our data science, engineering, and architecture teams. Our dedicated data science team is at the forefront of leveraging a blend of cutting-edge technology, including our proprietary and patented solutions, along with tools from leading vendors, to develop an exceptionally scalable data modeling platform.

Our overarching objective is to seamlessly deliver models through our robust API platform, catering to both internal stakeholders and external clients. Your pivotal role will focus on optimizing model accessibility and usability, thereby expediting model integration within our feature engineering teams. Ultimately, this streamlined process ensures swift model adoption, translating to enhanced value for our customers.

 

You Have:

We are excited about you because you have:

  • 3+ years of professional experience in Data Engineering or a related area of data science or software engineering
  • Advanced proficiency in Python, including expertise in data processing libraries (e.g.,  spaCy, Pandas), data visualization libraries (e.g., Matplotlib, Plotly), and familiarity with machine learning frameworks
  • Advanced proficiency using python API frameworks (e.g., FastAPI, Ray/AnyScale, AWS Sagemaker) to build, host. and optimize machine learning model inference APIs.
  • Intermediate proficiency working with the Databricks platform (e.g. Unity Catalog, Job/Compute, Deltalake) (or similar platform) for data engineering and analytics tasks
  • Intermediate proficiency working with the Machine Learning and Large Language Model (LLM) tools from AWS (e.g., Sagemaker, Bedrock) or other cloud vendors such Azure, or Google Cloud Platform
  • Intermediate proficiency with big data technologies and frameworks  (e.g., Spark, Hadoop)
  • Intermediate proficiency with SQL and relational databases (e.g., MySQL, PostgreSQL)
  • Basic proficiency in several areas apart from pure coding, such as monitoring, performance optimization, integration testing, security and more
  • Basic proficiency with Kafka (or similar stream-processing software) is a plus
  • Bachelor's Degree or equivalent experience preferred

Salary, Benefits & Perks:

Teammates begin receiving benefits on the first day of the month following or coinciding with one month of employment. Offerings include:

  • Paid Time Off -Invoca encourages a work-life balance for our employees. We have an outstanding PTO policy starting at 20 days off for all full-time employees. We also offer 16 paid holidays, 10 days of Compassionate Leave, days of volunteer time, and more.
  • Healthcare -Invoca offers a healthcare program that includes medical, dental, and vision coverage. There are multiple plan options to choose from. You can make the best choice for yourself, your partner, and your family.
  • Retirement - Invoca offers a 401(k) plan through Fidelity with a company match of up to 4%.
  • Stock options - All employees are invited to ownership in Invoca through stock options.
  • Employee Assistance Program -Invoca offers well-being support on issues ranging from personal matters to everyday-life topics through the WorkLifeMatters program.
  • Paid Family Leave -Invoca offers up to 6 weeks of 100% paid leave for baby bonding, adoption, and caring for family members.
  • Paid Medical Leave - Invoca offers up to 12 weeks of 100% paid leave for childbirth and medical needs.
  • Sabbatical -We thank our long-term team members with an additional week of PTO and a bonus after 7 years of service.
  • Wellness Subsidy - Invoca provides a wellness subsidy applicable to a gym membership, fitness classes, and more.
  • Position Base Range - $139,500 to $175,000Salary Range / plus bonus potential
  • Please note, per Invoca's COVID-19 policy, depending on your vaccine verification status, you may be required to work only from home / remotely. At this time, travel and in-person meetings will require verification. This policy is regularly reviewed and subject to change at any time

Recently, we’ve noticed a rise in phishing attempts targeting individuals who are applying to our job postings. These fraudulent emails, posing as official communications from Invoca aim to deceive individuals into sharing sensitive information. These attacks have attempted to use our name and logo, and have tried to impersonate individuals from our HR team by claiming to represent Invoca. 

We will never ask you to send financial information or other sensitive information via email. 

 

DEI Statement

We are committed to equal employment opportunity regardless of race, color, ancestry, religion, sex, national origin, sexual orientation, age, citizenship, marital status, disability, gender, gender identity or expression, or veteran status. We are proud to be an equal opportunity workplace.

#LI-Remote

See more jobs at Invoca

Apply for this job

13d

Senior Cloud Platform Engineer

SignifydDenver, CO; New York City, NY; United States (Remote);
Bachelor degreeterraformDesignjavaelasticsearchmysqltypescriptkubernetespythonAWSjavascript

Signifyd is hiring a Remote Senior Cloud Platform Engineer

Signifyd is looking to hire a Senior Cloud Platform Engineer responsible for the design, implementation, and management of our cloud-based infrastructure. You will lead a team of highly skilled engineers maintaining and automating a vast cloud-based computing environment supporting Signifyd’s decision platform. The candidate will collaborate with development teams and fellow cloud infrastructure engineers to address critical issues. Proficiency in cloud technologies, containers, Kubernetes, networking, security, scripting, automation, and platform engineering, ensuring seamless system operations. The candidate should possess strong technical aptitude, software development skills, analytical and communication skills, and exceptional problem-solving ability. For this role, we are open to hiring an SE3 or SE4 level.

What You'll Do

  • Collaborate with cross-functional teams to design, build, and maintain highly available, scalable, and secure cloud-based services, promoting efficiency and self-service principles.
  • Develop and maintain automation scripts and tools to streamline infrastructure provisioning, configuration, and deployment, empowering engineering teams.
  • Implement and manage Kubernetes clusters for container orchestration, monitoring, and scaling.
  • Drive an evolution of services to support cloud-native managed services, including an evolution of Kubernetes.
  • Drive efforts to enhance cloud infrastructure security, including access controls, encryption, and vulnerability assessments, focusing on engineering security solutions.
  • Collaborate on CI/CD (TeamCity) pipelines to automate software deployment, including the build platform (Java, Gradle Enterprise) and QA/Testing tooling to drive DevEx up and CFR to zero, emphasizing engineering and self-service automation.
  • Define and maintain cloud engineering best practices and standards to ensure design and implementation consistency.
  • Collaborate with software engineers to optimize applications for cloud deployment, emphasizing performance and scalability.
  • Evaluate emerging cloud and DevOps technologies, providing recommendations for integration into cloud engineering practices.
  • Participate in capacity planning and resource optimization for cost-effective cloud infrastructure usage.
  • Troubleshoot complex engineering issues, provide root cause analysis and propose engineering-focused solutions.
  • Create and maintain comprehensive documentation related to the cloud infrastructure, engineering practices, and security configurations.
  • Mentor and provide technical guidance to junior team members, fostering a culture of excellence.

 

What You'll Need

  • Proficiency in cloud platforms (AWS, GCP) with a focus on engineering best practices.
  • Extensive expertise in Kubernetes (self-managed and cloud-managed flavors, architectures, operations, etc.), cloud infrastructure (AWS and GCP), and ideally databases (at least one of MySQL, Cassandra, DynamoDB, or Elasticsearch)
  • Deep knowledge of best practices for cloud environments, including security, cost optimization, operational excellence, reliability, and performance efficiency.
  • In-depth knowledge of networking principles, protocols, and security best practices for high-performance solutions.
  • Strong understanding of DevOps practices, CI/CD pipelines (TeamCity, GitHub Actions, AWS CodePipeline), and infrastructure-as-code tools (e.g., Terraform, Pulumi).
  • Excellent problem-solving skills, effective in a fast-paced, collaborative environment.
  • Excellent experience in Infrastructure-As-Code (IaC) best practices (Terraform).
  • Experience in software development in general, with skills in a high-level language (e.g., Python, JavaScript, TypeScript, Java) and familiarity with modern development practices
  • Understanding of Cloud Observability, Monitoring, and Tracing tools (Datadog, CloudWatch, Jaeger, ELK) and how best to leverage to support effective MTTR and mitigate high CFR

#LI-Remote
 

Benefits in our US offices:

  • Discretionary Time Off Policy (Unlimited!)
  • 401K Match
  • Stock Options
  • Annual Performance Bonus or Commissions
  • Paid Parental Leave (12 weeks)
  • On-Demand Therapy for all employees & their dependents
  • Dedicated learning budget through Learnerbly
  • Health Insurance
  • Dental Insurance
  • Vision Insurance
  • Flexible Spending Account (FSA)
  • Short Term and Long Term Disability Insurance
  • Life Insurance
  • Company Social Events
  • Signifyd Swag

We also want to provide an inclusive interview experience for all, including people with disabilities. We are happy to provide reasonable accommodations to candidates in need of individualized support during the hiring process.

Signifyd provides a base salary, bonus, equity and benefits to all its employees. Our posted job may span more than one career level, and offered level and salary will be determined by the applicant’s specific experience, knowledge, skills, and abilities, as well as internal equity and alignment with market data.

USA Base Salary Pay Range
$160,000$200,000 USD

See more jobs at Signifyd

Apply for this job

13d

Quant Developer onsite or remote (in Germany or Austria)

Scalable GmbHWien, Austria, Remote
agileterraformsqlDesigndockerpythonAWSbackend

Scalable GmbH is hiring a Remote Quant Developer onsite or remote (in Germany or Austria)

Job Description

In this role you will be responsible for developing and fully automating the trading algorithms, encompassing risk, cost, and tax optimization in cost-effective burst computations with the capacity to handle 1mn trades in 10 minutes for less than €10. In the near to medium term, you will also focus on upgrading our technology for capital taxation and addressing regulatory demands associated with market risk.

Furthermore, you will productionize algorithmic models that autonomously react to client requests and market movements across multiple tax regimes. This involves customizing smart rebalancing, cash-flow management strategies, inventory adjustments, all of this carried out on a cutting edge stack with the capacity to handle hundreds of thousands of individual trading decisions in minutes.

The Quant Development team leverages its knowledge to bring unique insights to clients that are otherwise reserved for institutional investors. For example, the Smart Predict feature, developed by the Quant Development team, offers clients an execution probability for limit and stop orders, generated by a sophisticated machine learning model.

  • Develop hands-on in Python alongside a highly motivated team of software engineers and quant developers, driving transformative changes in the financial industry
  • Get to work on cutting edge technology and be part of modern software development practices (e.g. agile and self-sufficient teams, continuous integration and deployment, test automation, cloud-based infrastructure and tooling)
  • Manage the development of high-performance risk management tools serving regulatory purposes, near-real-time interactive dashboards and alerting systems overlooking the risk exposure in tens of thousands of positions
  • Create the next generation wealth management and brokerage services for everybody
  • Architect and deploy interfaces connecting the Scalable Capital Robo with key internal services to establish seamless connectivity with the external world
  • Contribute and develop data-driven ideas aimed at generating business value
  • Drive continuous improvements of data pipelines with respect to requirements and platform dependencies
  • Fully automate trading algorithms driven by pure quantitative evidence that autonomously manage billions in assets
  • Bridge the worlds of engineering and science by productionizing econometric models that react to market movements and client requests in hundreds of thousands of individual portfolios
  • Never implement any of the above in spreadsheet tools
  • Support investment managers, trading, backend, wealth management, risk

Qualifications

  • Excellent university degree in computer science, mathematics, natural sciences, or a similar field
  • Knowledge in econometrics with an emphasis on portfolio optimization and risk modelling
  • Passion for the global financial markets
  • Experience with convex optimization, exposure to libraries like cvxpy, scipy or cvxopt
  • Experience in quantitative modeling and data-driven decisions
  • Exposure and interest in our tech stack: Python, Docker, CI/CD pipelines,  Infrastructure as Code (Terraform), SQL
  • Experience with cloud providers like AWS
  • Knowledge of software development and software design in Python
  • Excellent communication skills that are clear, concise, and targeted towards your audience - engineering, product, or other stakeholders
  • Knowledge of relational databases / SQL
  • Fluent English language skills (written & spoken)
  • Proactive and independent working style, good time management, fair play

We would be happy if you write to us in the "message to the Hiring Manager" section about what excites you about the role and why you think you would be a great fit! Applications without such motivation will not be considered.

See more jobs at Scalable GmbH

Apply for this job

13d

Machine Learning Engineer

ShipwellRemote
agileBachelor's degreesqlDesignc++pythonAWS

Shipwell is hiring a Remote Machine Learning Engineer

Machine Learning Engineer

 

About Shipwell

At Shipwell, we empower supply chain efficiency and service effectiveness at scale. The Shipwell platform includes capabilities previously out of most shippers' technical reach and affordability today. Our solution combines everything shippers need, from transportation management and visibility to procurement, in a comprehensive, easy-to-use platform. It will adapt and scale as market and business demand change, allowing shippers to operate, manage, and optimize the shipping process seamlessly. Industry experts have recognized Shipwell's traction in the market and have differentiated Shipwell as a leader in the logistics industry. Awards include Gartner Magic Quadrant for TMS 2023, 2022, 2021, Food Logistics’ 2022 Top Software & Technology Providers, and FreightWaves’ FreightTech 2022 and 2021 Awards for Innovation and Disruption in Freight Industry. Shipwell was also named the fourth fastest-growing company in North America on the 2021, 2022, and 2023 Deloitte Technology Fast 500 and Forbes 2020 Next Billion-Dollar Startup.



Our Culture

 

Shipwell is a fast-paced, high-energy start-up that strives to build the future of shipping every day. Diversity of thought and cross-department collaboration is very important to us. We deliver open, honest, careful communication and work as hard as we play. We create & deliver solutions that are revolutionizing the industry, which brings excitement and purpose to our work. If you are looking for a place that will help you tap into your best work-self and give you hands-on experience building something big, then we invite you to come and build the future of shipping with us! 



About the Role

As a Machine Learning Engineer, you will contribute to the design, development, and maintenance of data pipelines, optimizing how we use AWS and other cloud infrastructure, and enabling data access for our various research projects. Your responsibilities will encompass extracting, transforming, and loading (ETL) data from various sources, developing and executing data integrity standards, and optimizing performance. You will collaborate closely with cross-functional teams and contribute to the development of scalable and efficient data architectures. This role provides a dynamic opportunity to leverage your expertise in data engineering and learn more about the data infrastructure at Shipwell. This will enable you to drive insights and support data-driven decision-making within our organization.

What we’re looking for:

  • Experience designing and implementing ML models and maintaining relevant data in a cloud environment
  • Experience working with DevOps to enable your team access to the tools they need
  • Contributing to every part of the machine learning product lifecycle
  • Proven track record of implementing data engineering best practices in all aspects of the data pipeline, i.e. ETL, data integrity, and monitoring
  • Demonstrable proficiency with Python, dbt, SQL, and modern ML tooling
  • Experience working with large-scale data model refactoring for better performance, interpretability, and maintainability
  • Experience with version control tools (GitHub, GitLab) and Agile methodologies.
  • Bachelor's Degree in a quantitative field such as Physics, Engineering, Computer Science, or demonstrated equivalent quantitative experience.
  • Excellent communication skills to effectively collaborate with different teams within the engineering org

 

What you’ll do when you get here:

  • Collaborate closely with our engineering, analytics, and data science teams as we take our machine learning projects and infrastructure to the next level
  • Right at the start you will be contributing to existing ML projects, creating and maintaining the data pipelines they need, and communicate the results to the organization
  • You will own all of the data and ML processes you create
  • You will become the expert on our machine learning and data infrastructure and make critical decisions in our path forward
  • You will have the opportunity to grow your skill set and take part in projects at the forefront of GenAI, ML, and data science in the logistics industry

 

Why Shipwell:

  • Enjoy working remotely with the added perk of a home office reimbursement
  • Unlimited Paid Time Off (PTO)
  • A robust healthcare package that includes medical, dental & vision benefits, short-term and long-term disability, AD&S coverage, and flexible/health savings accounts
  • 40K program where Shipwell matches up to 4%
  • A yearly learning and development budget
  • Subsidized internet, cell phone, fitness, and educational reimbursements
  • Virtual team-building events where fun and connection take center stage 
  • Join a vibrant, inclusive workplace shaped by friendly, talented individuals
  • Receive a technology package including a MacBook Pro
  • Employee Recognition Program to celebrate and incentivize hard work and success!

Please note that Shipwell is not offering sponsorship for work visas for this position. 

The Salary Range for this role is between $100,000 - $130,000/year. Compensation is based on a number of factors including market location, job-related knowledge, skills, and experience. 

Shipwell is an equal opportunity employer and welcomes all qualified applicants regardless of race, ethnicity, religion, gender, gender identity, sexual orientation, disability status, protected veteran status, or any other characteristic protected by law. We celebrate diversity and believe that experience comes in different forms. Diversity in our team makes for better problem-solving, more creative thinking, and ultimately a better product and company culture.

Even more important than your resume is a clear demonstration of impact, dedication, and the ability to thrive in a fast-paced and collaborative environment. Shipwell strives to have an inclusive work environment; so if you are hard-working & good at what you do then please come as you are.  We want you to contribute, grow, & learn at Shipwell.

We are looking forward to adding new perspectives to our team!

For more information about Shipwell visit shipwell.com, or connect with us on Twitter @shipwell, LinkedIn, and Facebook.com/Shipwellinc

See more jobs at Shipwell

Apply for this job

14d

IOT Full Stack Engineer

MetioraMadrid, Spain, Remote
sqlXamarinmongodbazurescrumiosgitjavac++androidpythonAWSfrontend

Metiora is hiring a Remote IOT Full Stack Engineer

Descripción del empleo

Estamos buscando a un/a #excepcional IOT Full stack engineer ???? que sea capaz de entender los retos de nuestros clientes, hacerlos suyos y que nos ayude a establecer relaciones a largo plazo con ellos, garantizando el éxito y la ejecución de los proyectos.

¿Qué esperamos de tu perfil profesional? 

  • Grado en Computer Science, Telecomunicaciones o electrónica
  • Al menos 2 años de experiencia en proyectos reales
  • Proactividad y pasión por la tecnología
  • Ganas de trabajar en equipo
  • Curiosidad intelectual y persistencia para resolver problemas

 

Requisitos

Necesitamos????

  • Experiencia desarrollo, diseño y prototipo de hardware y electrónica (Arduino, Raspberry Pi, Intel IoT Platform, PICs, Zigbee)
  • Experiencia con redes de comunicación y protocolos: TCP/IP, HTTP, FTP, MQTT 
  • Experiencia con entornos cloud (Azure, AWS, GCP)
  • Lenguajes de programación: Python, C#
  • Enfocado en la calidad, escalabilidad y código limpio
  • Bases de datos (SQL y derivados)
  • Web frontend (Django / Celery)
  • Metodologías ágiles (SCRUM)
  • Bases de datos no relacionales (MongoDB / Redis / Clickhouse)
  • Pruebas unitarias e integración continua
  • Experiencia con control de versiones (SVN / GIT)
  • Buen nivel de inglés

Valorable????

  • Experiencia con interfaces inalámbricas: 802.15.4, LoRaWAN, Bluetooth, BLE 4.0, WiFi, 3G, GPS, RFID
  • Experiencia con arquitecturas de bus digitales e interfaces (RS-232, USB, UART, CAN-Bus)
  • React/Node.JS
  • Desarrollo de aplicaciones móviles (iOS & Android con Xamarin)
  • C++, Java
  • Experiencia colaborando en proyectos Open Source
     

See more jobs at Metiora

Apply for this job

14d

Principal AI/ML Data Scientist

ThousandEyesSan Francisco, CA or New York, NY or Remote
Bachelor's degreeDesignazurec++pythonAWS

ThousandEyes is hiring a Remote Principal AI/ML Data Scientist

Who We Are

The name ThousandEyes was born from two big ideas: the power to see things not ordinarily possible and the ability to collect insights from a multitude of vantage points. As organizations rely more on cloud services and the Internet, the network has become a black box they can't understand. Our Internet and cloud intelligence platform delivers the only collectively powered view of the Internet, cloud, and SaaS platforms, helping enterprises and service providers work together to identify problems before it impacts revenue, damages brand reputation, or halts employee productivity.

In August 2020, Cisco Systems completed the acquisition of ThousandEyes, which now forms the ThousandEyes Business Unit within Cisco’s Network Services Business Group and is a foundational component of Cisco’s growing Observability business.

About The Team

ThousandEyes is the industry leader In digital experience monitoring, delivering visibility into the entire digital delivery chain. Our innovative solutions empower organizations with actionable insights into network performance, application behavior, and user experience across cloud, Internet, and enterprise networks. 

The applied research team is at the forefront of digital experience monitoring innovation. Using our extensive and unmatched data, we craft and refine new algorithms to unlock a holistic and end-to-end view of digital experience.

About The Role

We are seeking a Principal AI/ML to join our applied research team. In your role within the team, you will lead the integration of AI and ML technologies into our solutions. You will work alongside top-class networking researchers and data scientists to design and prototype novel solutions and help drive the evolution of intelligent networking products. Collaborating closely with top-tier engineering and product teams, you will then take your pioneering ideas from prototypes to full-scale production

Qualifications

  • Master’s or Ph.D. in Computer Science, Electrical Engineering, or related field
  • Strong background in artificial intelligence, machine learning, and deep learning techniques
  • Minimum of 3 years of hands-on experience developing innovative products utilizing AI/ML technologies (including scaling and deploying Machine Learning models)
  • Experience with data preprocessing, feature engineering, and model evaluation
  • Statistical and time series analysis expertise
  • Strong programming skills, especially Python
  • Proficiency in machine learning libraries and frameworks (TensorFlow, PyTorch, etc.)
  • Experience with cloud computing platforms for deploying ML models (AWS, Azure, etc.)
  • Proficiency in working with large-scale datasets (Spark, Hadoop, etc.) and uncovering insights

A plus if you have

  • Knowledge of networking protocols (e.g., TCP/IP, UDP, DNS) and network architecture
  • Proven industry experience applying AI/ML in networking products

 

Cisco values the perspectives and skills that emerge from employees with diverse backgrounds. That's why Cisco is expanding the boundaries of discovering top talent by not only focusing on candidates with educational degrees and experience but also placing more emphasis on unlocking potential. We believe that everyone has something to offer and that diverse teams are better equipped to solve problems, innovate, and create a positive impact.

We encourage you to apply even if you do not believe you meet every single qualification. Not all strong candidates will meet every single qualification. Research shows that people from underrepresented groups are more prone to experiencing imposter syndrome and doubting the strength of their candidacy. We urge you not to prematurely exclude yourself and to apply if you're interested in this work.

Cisco is an Affirmative Action and Equal Opportunity Employer and all qualified applicants will receive consideration for employment without regard to race, color, religion, gender, sexual orientation, national origin, genetic information, age, disability, veteran status, or any other legally protected basis. Cisco will consider for employment, on a case by case basis, qualified applicants with arrest and conviction records. 

US – COMPENSATION RANGE – MESSAGE TO APPLICANTS

173400 USD - 322100  USD

Message to applicants applying to work in the U.S.:

When available, the salary range posted for this position reflects the projected hiring range for new hire, full-time salaries in U.S. locations, not including equity or benefits. For non-sales roles the hiring ranges reflect base salary only; employees are also eligible to receive annual bonuses. Hiring ranges for sales positions include base and incentive compensation target. Individual pay is determined by the candidate's hiring location and additional factors, including but not limited to skillset, experience, and relevant education, certifications, or training. Applicants may not be eligible for the full salary range based on their U.S. hiring location. The recruiter can share more details about compensation for the role in your location during the hiring process.

U.S. employees have access to quality medical, dental and vision insurance, a 401(k) plan with a Cisco matching contribution, short and long-term disability coverage, basic life insurance and numerous wellbeing offerings. Employees receive up to twelve paid holidays per calendar year, which includes one floating holiday, plus a day off for their birthday. Employees accrue up to 20 days of Paid Time Off (PTO) each year and have access to paid time away to deal with critical or emergency issues without tapping into their PTO. We offer additional paid time to volunteer and give back to the community. Employees are also able to purchase company stock through our Employee Stock Purchase Program.

Employees on sales plans earn performance-based incentive pay on top of their base salary, which is split between quota and non-quota components. For quota-based incentive pay, Cisco pays at the standard rate of 1% of incentive target for each 1% revenue attainment against the quota up to 100%. Once performance exceeds 100% quota attainment, incentive rates may increase up to five times the standard rate with no cap on incentive compensation. For non-quota-based sales performance elements such as strategic sales objectives, Cisco may pay up to 125% of target. Cisco sales plans do not have a minimum threshold of performance for sales incentive compensation to be paid.

See more jobs at ThousandEyes

Apply for this job

14d

Team Lead Data Science (f/m/x)

AUTO1 GroupBerlin, Germany, Remote
sqlazurepythonAWS

AUTO1 Group is hiring a Remote Team Lead Data Science (f/m/x)

Job Description

  • Collaborate closely with your team and key stakeholders to convert business requirements into Machine Learning solutions
  • Foster a culture that values data-driven decision-making within the organization and aid in the enhancement of our data platform
  • Offer ML and engineering expertise and ensure your team builds, deploys and maintains high standards models
  • Drive innovation and creativity within your team, encouraging them to explore new data science techniques and approaches
  • Empower your team by supporting members to grow and take ownership of data science projects
  • Continually assess and improve the team's performance, setting clear expectations and providing constructive feedback

Qualifications

  • Deep knowledge in statistical and quantitative analysis, coupled with practical expertise in SQL and Python, honed over several years. Experience with cloud platforms like AWS, Azure, or Google Cloud is a significant advantage
  • Proven leadership skills, with a track record of delivering end-to-end Machine Learning products in collaborative environments
  • Excellent communication skills: you can effectively interact with stakeholders to understand their requirements, as well as communicate complex technical concepts to your data science colleagues
  • Machine Learning: hands-on experience with a wide array of machine learning methods, along with the ability to discern the most suitable technique for various problems
  • Strong motivational and managerial skills to guide, support, and inspire your team to reach their objectives

See more jobs at AUTO1 Group

Apply for this job

14d

Senior Systems Engineer, Cloud Infrastructure

ServiceNowKirkland, Washington, Remote
agileterraformansibleazurerubyjavalinuxpythonAWS

ServiceNow is hiring a Remote Senior Systems Engineer, Cloud Infrastructure

Job Description

This position reports to Sr. Manager, Systems Engineering Cloud Advancement Team

ServiceNow is changing the way people work. With a service-orientation toward the activities, tasks, and processes that make up day-to-day work life, we help the modern enterprise operate faster and be more scalable than ever before.

ServiceNow has been serving customers for 17 years and has built a resilient and robust business, with a solid customer base. The Cloud Infrastructure Systems Engineering team at ServiceNow is looking for help to architect and build the server infrastructure and core services that allow our SaaS platform to run at scale and with high availability. We are looking for a skilled Systems Engineer who can help craft the technology and processes needed to sustain ServiceNow’s growth while gaining valuable experience in modern systems and software development. This role is available in our Kirkland, Washington, San Diego, California offices, or applicable remote locations.

What you get to do in this role:

  • Support, develop, and maintain software-defined declarative infrastructure, at scale.
  • Support build systems, web services, and automation tools that are thoroughly specified, documented, and testable.
  • Support, review, build orchestration workflows by leveraging features of the ServiceNow platform.
  • Research and implement new open-source and commercial tools, technologies, and methodologies.
  • Collaborate with peer teams who have built world-class networking and orchestration solutions.

Qualifications

To be successful in this role you have:

  • 4+ years of relevant experience
  • Can figure things out. You will have documentation and many peers to turn to for help, but your work will touch many interconnected systems and technologies; too many to rely solely on others’ knowledge. To succeed you will need to investigate and discover on your own, being self-driven and accountable.
  • Is very comfortable building and maintaining Linux-based systems through automated tooling such as (but not limited to) Terraform, Puppet, Ansible, PowerShell, etc.
  • Is comfortable with virtualization using both public and private cloud infrastructure technologies such as Microsoft Azure, Amazon EC2, Google Cloud, etc.
  • Is comfortable designing, authoring, testing, and debugging code in a popular systems language such as Python, Go, Java, or Ruby
  • Has a working understanding of related infrastructure concepts such as IP networking, block, and file storage, load-balancers, etc.
  • Has a working understanding of related internet protocols such as DNS, LDAP, NTP, SMTP, HTTP, etc.
  • Is an excellent oral and written communicator
  • Has experience working with Agile software development methodologies (Previous SPRINT/SCRUM experience)
  • Has integrity, and honesty and can uphold ServiceNow’s values

While these are not ‘musts’, they are undoubtedly nice-to-have:

  • Full time software development experience
  • Public cloud experience running production services at scale: (Azure, AWS, GCP, etc.)
  • Public cloud experience with on-prem to Hybrid or full Public Cloud native migrations which include: Scoping/planning performance characteristics in the migration to Public Cloud infrastructures (IaaS or IaC)
  • Extensive experience with performance monitoring, performance troubleshooting, and performance reporting of Public Cloud services & infrastructure
  • Public cloud performance bottleneck troubleshooting, debug experience with control plane issues related to the performance of services or infrastructure running in the Public Cloud (Azure, AWS, GCP, etc.)
  • Relevant Azure, AWS or GCP certifications
  • Deep experience with Terraform (any provider, but especially Azure)

GCS-23

 

 

For positions in California (outside of the Bay Area), we offer a base pay of $123,300 - $209,700, plus equity (when applicable), variable/incentive compensation and benefits. Sales positions generally offer a competitive On Target Earnings (OTE) incentive compensation structure. Please note that the base pay shown is a guideline, and individual total compensation will vary based on factors such as qualifications, skill level, competencies and work location. We also offer health plans, including flexible spending accounts, a 401(k) Plan with company match, ESPP, matching donations, a flexible time away plan and family leave programs (subject to eligibility requirements). Compensation is based on the geographic location in which the role is located, and is subject to change based on work location. For individuals who will be working in the Bay Area, there is a pay enhancement for positions located in that geographical area; please contact your recruiter for additional information.

See more jobs at ServiceNow

Apply for this job

14d

Senior Engineering Manager (Mobile)

NextivaMexico (Remote)
agilekotlinDesignUI/UX designswiftmobileazureiosqaflutterandroidAWS

Nextiva is hiring a Remote Senior Engineering Manager (Mobile)

Redefine the future of customer experiences. One conversation at a time.

We’re changing the game with a first-of-its-kind, conversation-centric platform that unifies team collaboration and customer experience in one place. Powered by AI, built by amazing humans.

Our culture is forward-thinking, customer-obsessed and built on an unwavering belief that connection fuels business and life; connections to our customers with our signature Amazing Service®, our products and services, and most importantly, each other. Since 2008, 100,000+ companies and 1M+ users rely on Nextiva for customer and team communication.

If you’re ready to collaborate and create with amazing people, let your personality shine and be on the frontlines of helping businesses deliver amazing experiences, you’re in the right place. 

Build Amazing - Deliver Amazing - Live Amazing - Be Amazing

 

Nextiva is currently seeking bright and talented individuals for a Senior Engineering Manager (Mobile) position to join our expanding development team. As a Senior Engineering Manager, you will lead the technical strategy, development of our current and future Mobile platform ecosystem. You will play a critical role in shaping the future of our product portfolio, working closely with cross-functional teams to deliver a product that exceeds user expectations. Your expertise in mobile application development, coupled with a passion for creating scalable, high-quality solutions, will drive the success of this pivotal project. 

Key Responsibilities: 

Technical Leadership and Innovation: 

  • Leading the development and delivery of the mobile application(s), ensuring high performance, reliability, and scalability. 
  • Staying abreast of the latest mobile technologies, frameworks, and best practices to keep the application ahead of the curve. 
  • Making key architectural and technology stack decisions, balancing innovation with practicality. 

Team Building and Management: 

  • Hiring, mentoring, and developing a high-caliber mobile engineering team, fostering a culture of excellence, innovation, and continuous improvement. 
  • Setting clear expectations and goals, providing regular feedback, and conducting performance reviews. 
  • Encouraging a collaborative and inclusive team environment where members can learn from each other and grow. 

Product Strategy and Vision: 

  • Collaborating with product management, design, and other stakeholders to define the product roadmap and strategy. 
  • Ensuring the team's work aligns with the company's goals and customer needs, adjusting as needed based on feedback and market trends. 
  • Championing the mobile product internally and externally, understanding user needs, and advocating for solutions that meet those needs. 

Project Management: 

  • Planning and managing the mobile engineering team's projects and timelines, ensuring efficient workflows andtimelydelivery of features and updates. 
  • Implementing agile methodologies and continuous integration/continuous delivery (CI/CD) practices to streamline development and deployment processes. 
  • Managing risks,anticipatingpotential issues, and implementing contingency plans to mitigate impacts on project timelines and quality. 

Quality Assurance: 

  • Overseeing the development of automated testing frameworks to ensure the application's quality, performance, and security. 
  • Working closely with the QA team to prioritize and fix bugs, improving the overall user experience. 
  • Establishing andmonitoringkey performance indicators (KPIs) for app performance and user satisfaction. 

Qualifications: 

  • 8+ years of experience in mobile application development, with a proven track record of leading successful launch for moderate to complex product use-cases. 
  • 5+ years of experience of leading and managing teams with people management function.  
  • Demonstrated experience with atleast two major product launches, showcasing your ability to lead a project from conception through to market release with significant impact. Include specifics about your role in these launches, the challenges faced, and how they were overcome. 
  • Deep understanding of mobile app architecture, design patterns (e.g., MVC, MVVM), and mobile app lifecycle. 
  • Extensive experience with mobile development languages (e.g., Swift for iOS, Kotlin for Android) and frameworks. 
  • Knowledge of mobile app security best practices, performance optimization, and cross-platform development tools (e.g., React Native, Flutter). 
  • Excellent leadership and communication skills, with the ability to inspire and mentor team members. 
  • A portfolio of released applications on the App Stores 

Preferred Experience 

  • Thrive in environments of ambiguity, demonstrating flexibility and a proactive approach to tackling challenges and driving projects to completion. 
  • Experience with cloud services (e.g., AWS, Azure, Google Cloud) and integrating mobile apps with cloud-based systems and APIs. 
  • Familiarity with UI/UX design principles and customer-centric development. 
  • Contributions to open-source projects or public GitHub repositories. 

What We Offer: 

  • Competitive salary and benefits package. 
  • Flexible working hours and remote work options. 
  • A dynamic and inclusive work environment where your contributions directly impact the company's success. 
  • Opportunities for professional growth and development, including access to learning resources. 
  • A chance to work on cutting-edge projects with a talented and passionate team. 

Nextiva Core Competencies / DNA:

  • Drives Results:  The successful candidate will be action oriented, with a passion for solving problems.  They will bring clarity and simplicity to ambiguous situations.  This individual will challenge the status quo; asking what we can do differently and finding ways to create and build more success.  S/he is a change agent, prepared to lead and drive changes as we transform. 
  • Critical Thinker:  The successful candidate is fact based and data driven, able to understand and articulate the “why,” identifying key drivers and learning from the past.  They are forward-thinking, anticipating problems before they arise.  They’ll recommend and action well thought out solutions, understanding the risks and dependencies. 
  • Right Attitude:  The successful candidate will be team-oriented, collaborative and competitive with a winning mindset; they’re resilient and able to easily bounce back from setbacks.  S/he will be able to zoom in / out, willing to be hands-on to help solve important problems while being a motivating figure for the team along the way.  S/he will embrace a culture of service and learning with a focus on caring, supporting and respecting our customers and team members.

Rewards & Benefits: 

✅ Major Health insurance for you and for your legal partner and children under 25 years
✅ Vision and Dental covered
✅ Life Insurance – 24 times your monthly salary
✅ 30-day Christmas Bonus (Aguinaldo)
✅ 50% Vacation premium
✅ 12 days for vacations on your first-year anniversary
✅ Newly hired full-time employees of Nextiva earn ten (10) personal days before their first anniversary
✅ After your first year you will be entitled to 5 personal days each year after each anniversary date additional to your vacation days
✅ Company matched Food Vouchers – You receive 1 x monthly UMA (Unidad de Medida y Actualización) per month
✅ Company matched savings fund – 13% of your monthly salary capped to 1.3 times the annual value of the UMA
✅ $500 MXN monthly Telecommunications stipend for remote workers (non applicable for 100% on-site roles)

To check out what’s going on at Nextiva, check us out on Instagram, Instagram (MX), YouTube, LinkedIn, and the Nextiva blog

In 2022, Nextiva has been recognized by Comparably as the ‘Best Place to Work’ in the following categories: Best Company Leadership, Best CEO for Women, Best Global Culture, and Best Places to Work in Phoenix.

Additional workplace awards include 2021 LinkedIn Talent Employee Engagement Champion, Comparably’s Best CEO 2021, Best Company Culture 2021 and 2018, Best Company Compensation 2022, 2021 and 2019, and Glassdoor’s 2020 Best Places to Work.

#LI-XX   #LI-Remote

See more jobs at Nextiva

Apply for this job

14d

Tech lead Full Stack

DevoteamRabat, Morocco, Remote
agileDesignmongodbsassgitjavadockerpostgresqlmysqltypescriptcsskubernetesangularAWSjavascript

Devoteam is hiring a Remote Tech lead Full Stack

Description du poste

LES MISSIONS DU DEVELOPPEUR FULL-STACK JAVA/ANGULAR

  • Vous interviendrez sur les nombreux projets et problématiques de nos clients,
  • Vous participerez activement aux phases projet (analyse/développement, mise en place
    et livraison) en proposant des solutions.
  • Vous réaliserez “from scratch” des projets,
  • Vous adresserez les problématiques d’architecture, de testabilité, de maintenabilité en
    proposant des solutions,
  • Nous partagerons les bonnes pratiques et sujets innovants quotidiennement,
  • Nous apprendrons grâce à vous et vous apprendrez de nous,
  • Vous participerez à la vie du pôle web (BBL, crossDT, soirée technique, …),

LE CADRE DU DEVELOPPEMENT FULL-STACK JAVA/ANGULAR

  •  Java 10+ (Spring Boot, Spring Security, Spring JPA, Spring Data, Maven, Gradle), J2EE,Hibernate.
  • JavaScript (TypeScript, Angular 6+), SASS, Karma, Jasmine.
  • PostgreSQL, DynamoDB. MongoDB, MySQL, MS Server, H2.
  • AWS, Google Cloud, Microsoft Azure.
  • Git, Docker (Swarm, Rancher, Kubernetes, Compose).
  • Architecture SOA, WOA, Microservices.
  • Nous opérons dans un cadre de Devops (CI/CD), de la manière la plus agile possible.

Qualifications

De formation Bac+5, d’une École d’Ingénieur ou équivalent, tu es non seulement capable d’apprendre et de réaliser des développements en technologies web innovantes mais aussi de comprendre, débugger et maintenir des bases de code moins récentes.

Tu sais prendre du recul sur tes réalisations et celles de tes collègues, ainsi que proposer et mettre en places des améliorations. La qualité, la robustesse, l’optimisation et les performances, ainsi que la précision de l’interface sont des concepts qui importent pour toi.

Nous recherchons des personnes ayant déjà +5 années d’expérience en développement Java et Angular, ainsi qu’en intégration graphique & responsive design (HTML, CSS), et qui ont l’envie d’intervenir sur des projets ambitieux et de partager leur passion.

Alors si tout ceci te correspond, si tu souhaites progresser et produire, apprendre et partager, rejoins-nous !

See more jobs at Devoteam

Apply for this job

14d

Cloud Hybride Engineer H/F - Innovative Tech

DevoteamLevallois-Perret, France, Remote
terraformansibleazurec++kuberneteslinuxAWS

Devoteam is hiring a Remote Cloud Hybride Engineer H/F - Innovative Tech

Description du poste

Vos principales responsabilités en tant que Cloud Hybrid Vmware Engineer

Voici une liste non exhaustive de vos missions au quotidien, nous vous faisons confiance pour les prendre en main et les enrichir à votre façon ????

L’analyse des besoins clients

  • Participer aux ateliers de cadrage des solutions afin d’étudier les besoins clients

  • Aider à la définition d’architectures de Cloud Privé et de Cloud Hybride sur la base de solutions VMWare

  • Participer à la conception et la mise en œuvre de solutions VMware Cloud Foundation avec vCenter, VSAN et NSX-T

  • Participer à la rédaction des documents d'architecture (HLD, LLD, DEX) et de préconisations

Le déploiement et l’automatisation des architectures VMWare

  • Mettre en place les outils d’automatisation

  • Déployer et industrialiser les architectures cibles

  • Mettre en oeuvre les solutions de monitoring adaptées à l’environnement client

  • Veiller à la sécurité et la fiabilité des environnements déployés

  • Optimiser les performances des différents outils et participer à la résolution d’incidents

  • Analyser et proposer des axes d’amélioration sur les architectures pour optimiser les composants

Participation aux opérations de maintenance

  • Optimiser les performances des infrastructures VMWare et participer à la résolution d’incidents

  • Gérer les utilisateurs, les groupes, les rôles et les autorisations

  • Gérer la maintenance continue, par exemple l'installation de Service Pack, les correctifs, les mises à jour de logiciels, etc.

Où réaliserez-vous vos missions ? Chez des clients grands comptes de la banque, de l’assurance, de l’industrie, du retail de la Défense, du luxe ou encore de l’énergie, porteurs de projets innovants.

Qualifications

Ce que vous apporterez à la Tribu ?

Consultant.e VMWare, issu.e d’école d’ingénieurs ou d’un Master 2 en informatique, vous êtes doté.e d’un excellent relationnel, d’un sens prononcé du service et de la qualité. Vous aimez travailler en équipe, et parlez couramment français et anglais.

Vous avez une première expérience professionnelle sur les technologies et les outils de la virtualisation (KVM, XEN et plus particulièrement VMWare Cloud Foundation, VSphere 6.5,6.7 ou 7, VRealize Automation, vRealize Orchestrator, VSAN, NSX-T, vMotion, DRS, SRM,...). 


Vous connaissez et vous vous voulez progresser sur : 

  • les architectures de stockage (NAS/ SAN/ DAS), 

  • les architectures réseaux et télécoms

  • les outils tiers (Terraform, Ansible, Veeam, SCCM, Citrix, PowerShell, …)

  • et vous avez un socle de connaissances confirmé en environnement Windows Server, Linux et Kubernetes

Vous souhaitez affirmer une trajectoire professionnelle vers des sujets d’automatisation d’infrastructure et de cloud privé ou hybride (AWS, Azure, GCP, OVH). 

Vous souhaitez développer votre sens critique en tant que consultant.e au regard des problématiques Cloud et des adhérences middlewares aux éléments sous-jacents des architectures du système d’information et des applications. 

[Cherry on the cake????]

Votre curiosité au sujet des risques liés à la sécurité des infrastructures virtuelles, des normes applicables (ANSSI, NIST, CIS,…) de cybersécurité serait un plus.
 

Et qu’est ce que Devoteam vous offre en échange?

  • Un CDI, pour se projeter ensemble sur le long terme

  • Un salaire attractif en lien avec votre expérience et les tendances du marché

  • Une base de travail en Ile de France et un accord télétravail permettant une meilleure flexibilité 

  • Des avantages comprenant mutuelle, prévoyance santé, CSE, mais aussi des compensations de vos frais internet et installations relatives au télétravail

  • Des challenges organisés tout au long de l’année avec de très jolis gains (voyages, matériels technologiques, accès à des événements….)

  • Un plan de carrière personnalisé avec des formations et certifications en lien avec votre trajectoire en bénéficiant des cursus, labs, formateurs du premier partenaire AWS en France

  • De multiples possibilités de mobilité, géographique mais aussi inter communauté, vous permettant d’évoluer en fonction de vos appétences technologiques ou métier mais aussi selon des projets plus personnels 

  • Un esprit de communauté fort autour de vos technologies de prédilection, au travers d’événements internes vous permettant d’interagir, célébrer et continuer d’apprendre

  • Une réelle possibilité de rayonner et partager vos connaissances et votre vision par le biais de conférences, meetups ou articles 

  • Plus de 30 clubs Happiness@Devoteam qui te permettent de partager et laisser libre cours à tes passions (running, art, football, musique, gastronomie, yoga, …)

Intéressé.e ????‍♀️????‍♂️?

N’attendez plus et postulez à l’offre!

La suite du process se déroulera en toute confidentialité et bienveillance: rencontre avec l’équipe Recrutement, Sales et managériale, avec au moins un rendez-vous en présentiel pour venir découvrir nos locaux et sentir de plus près la bonne humeur et l’énergie de nos équipes ????

Nous veillons à vous faire vivre des process de recrutement les plus dynamiques possibles et nous engageons à vous faire un retour sous 72h après chaque étape.

Le Groupe Devoteam oeuvre pour l'égalité des chances, pour la promotion de ses collaboratrices et de ses collaborateurs au mérite et lutte activement contre toute forme de discrimination. Nous sommes persuadés que la diversité contribue à la créativité, au dynamisme et à l'excellence de notre organisation.
Tous nos postes sont ouverts aux personnes en situation de handicap.

See more jobs at Devoteam

Apply for this job

14d

SysOps Engineer H/F - Innovative Tech

DevoteamLevallois-Perret, France, Remote
terraformansibleazurec++kuberneteslinuxjenkinspythonAWS

Devoteam is hiring a Remote SysOps Engineer H/F - Innovative Tech

Description du poste

Vos principales responsabilités en tant que SysOps Engineer 

Voici une liste non exhaustive de vos missions au quotidien, nous vous faisons confiance pour les prendre en main et les enrichir à votre façon ????

Déploiement et automatisation des infrastructures

  • Mettre en place les outils d’automatisation et de provisionning des infrastructures (Ansible, Jenkins, Terraform,...) et gérer leur cycle de vie avec des solutions comme GitHub, GitLab et Azure DevOps 

  • Déployer et industrialiser les architectures et les services cibles

  • Mettre en oeuvre les solutions de sauvegardes et de supervision adaptées à l’environnement client

  • Veiller à la sécurité et la fiabilité des environnements déployés

  • Analyser et proposer des axes d’amélioration sur les architectures pour optimiser les composants

Participation aux opérations de maintenance

  • Optimiser les performances des infrastructures et participer à la résolution d’incidents

  • Gérer le cycle de vie des infrastructures et des services déployés

  • Gérer les utilisateurs, les groupes, les rôles et les autorisations

  • Gérer la maintenance continue, par exemple l'automatisation des déploiements des Service Pack, les correctifs, les mises à jour de logiciels, etc.

Où réaliserez-vous vos missions ? Chez des clients grands comptes de la banque, de l’assurance, de l’industrie, du retail de la Défense, du luxe ou encore de l’énergie, porteurs de projets innovants.

???? A terme, vous avez envie d'évoluer vers un poste d’architecte infrastructure et Cloud, de Chef de Projet, de Tech Lead ou d'Expert Cloud ?

Notre stratégie pour accompagner nos consultants est de former nos équipes par des Gourous et de les certifier grâce à nos partenaires privilégiés (VMware, AWS,

Microsoft, Google, Red Hat...) ou encore sur les technologies Cloud et DevOps (Terraform, Kubernetes, Ansible,...)

Pour activer cette trajectoire, My Devoteam Academy vous proposera des actions de formation, de parrainage  et des certifications avec nos partenaires, ainsi qu’un dispositif d’évaluation personnel régulier, notamment :

Aussi, vous trouverez du soutien pour approfondir certains sujets grâce à Devolab (plateforme de labs à disposition des consultants). 

 

Qualifications

Ce que vous apporterez à la Tribu ?

[Les compétences idéales] 

Consultant.e infrastructure et automatisation, issu d’école d’ingénieurs ou en Master 2 en informatique, vous êtes doté.e d’un excellent relationnel, d’un sens prononcé du service et de la qualité. Vous aimez travailler en équipe, et parlez couramment français et anglais.

Vous avez une première expérience professionnelle sur Terraform, Ansible, PowerShell, Python ainsi qu’un socle de connaissances confirmé en environnement Windows Server, Linux et Kubernetes.

Vous souhaitez affirmer une trajectoire professionnelle vers des sujets d’automatisation d’infrastructure et de Cloud Privé ou hybride (AWS, Azure, GCP, OVH).

Et qu’est ce que Devoteam vous offre en échange?

  • Un CDI, pour se projeter ensemble sur le long terme

  • Un salaire attractif en lien avec votre expérience et les tendances du marché

  • Une base de travail en Ile de France et un accord télétravail permettant une meilleure flexibilité 

  • Des avantages comprenant mutuelle, prévoyance santé, CSE, mais aussi des compensations de vos frais internet et installations relatives au télétravail

  • Des challenges organisés tout au long de l’année avec de très jolis gains (voyages, matériels technologiques, accès à des événements….)

  • Un plan de carrière personnalisé avec des formations et certifications en lien avec votre trajectoire en bénéficiant des cursus, labs, formateurs du premier partenaire AWS en France

  • De multiples possibilités de mobilité, géographique mais aussi inter communauté, vous permettant d’évoluer en fonction de vos appétences technologiques ou métier mais aussi selon des projets plus personnels 

  • Un esprit de communauté fort autour de vos technologies de prédilection, au travers d’événements internes vous permettant d’interagir, célébrer et continuer d’apprendre

  • Une réelle possibilité de rayonner et partager vos connaissances et votre vision par le biais de conférences, meetups ou articles 

  • Plus de 30 clubs Happiness@Devoteam qui te permettent de partager et laisser libre cours à tes passions (running, art, football, musique, gastronomie, yoga, …)

​​​​Intéressé.e ????‍♀️????‍♂️?

N’attendez plus et postulez à l’offre!

La suite du process se déroulera en toute confidentialité et bienveillance: rencontre avec l’équipe Recrutement, Sales et managériale, avec au moins un rendez-vous en présentiel pour venir découvrir nos locaux et sentir de plus près la bonne humeur et l’énergie de nos équipes ????

Nous veillons à vous faire vivre des process de recrutement les plus dynamiques possibles et nous nous engageons à vous faire un retour sous 72h après chaque étape.

Le Groupe Devoteam oeuvre pour l'égalité des chances, pour la promotion de ses collaboratrices et de ses collaborateurs au mérite et lutte activement contre toute forme de discrimination. Nous sommes persuadés que la diversité contribue à la créativité, au dynamisme et à l'excellence de notre organisation.
Tous nos postes sont ouverts aux personnes en situation de handicap.

See more jobs at Devoteam

Apply for this job

14d

Python DevOps Developer H/F - Innovative Tech

DevoteamLevallois-Perret, France, Remote
agilejiraterraformansibleazureapigitc++dockerkuberneteslinuxjenkinspythonAWS

Devoteam is hiring a Remote Python DevOps Developer H/F - Innovative Tech

Description du poste

Vos principales responsabilités en tant que Python DevOps Developer 

Voici une liste non exhaustive de vos missions au quotidien, nous vous faisons confiance pour les prendre en main et les enrichir à votre façon ????

  • Comprendre le besoin utilisateur et y répondre en livrant régulièrement des fonctionnalités ayant de la valeur métier,

  • Assurer le développement d’outils visant à industrialiser/automatiser le déploiement sur les différents environnements du développement à la production (conception & structuration, qualité de code, pair-programming, revue de code…),

  • Accompagner les équipes de dev par la mise en place de pipelines CI/CD, d’Infra As code et de conteneurs pour leurs applications,

  • Accompagner les équipes de production dans la mise en place de bonnes pratiques de delivery de ces outils (gestion de sources, gestion de configuration, automatisation des tests…) ;

  • Apporter la culture du développement agile dans les différentes features teams, faciliter la coopération et l'entraide, partager la connaissance via les outils

  • Intervenir au sein d’écosystèmes techniques DevOps et des plateformes de CI/CD complexes pour des milliers d’utilisateurs 

  • Assurer une veille technologique et s'intéresser aux nouvelles pratiques émergentes

Selon les projets, voici les technologies que vous serez amené.e à rencontrer :

  • Scripting : Python, Bash, Shell

  • Programmation : Python, Django, Flask

  • Architectures orientées services (MicroServices & REST API)

  • CI/CD : Gitlab, GitHub, Jenkins, Nexus, Sonarqube

  • Versionning : Git

  • Containers : Docker, Kubernetes

  • Infrastructure As Code : Terraform, Ansible

  • Collaboration : Jira, Confluence

  • Tests : Selenium

  • Système : Windows, Linux

  • Cloud : AWS, AZURE, GCP

Qualifications

Ce que vous apporterez à la Tribu ?

[Les compétences idéales] 

Diplômé.e d’une École d’Ingénieurs ou d’un Master 2 en IT, vous êtes passionné.e par le langage Python dans des contextes Cloud / DevOps et avez au moins 3 ans d’expérience en scripting ou développement sur Python 3 et ses librairies. Que vous veniez du Dev, des Ops, du DevOps, vous avez acquis de solides compétences en automatisation et amélioration continue.

Vous avez déjà une première expérience dans l’utilisation ou la mise en place d’outils de l’écosystème DevOps - CI/CD et vous souhaitez aller plus loin sur ces sujets.

[Cherries on the cake????]

  • Une expérience des frameworks Flask & Django et des outils d’industrialisation (Git, Jenkins, Ansible, Docker…)

  • Une expérience en utilisation ou implémentation de plateformes CI/CD avec des composants “Enterprise” (GitLab / GitHub)

  • Des connaissances et de la pratique en conteneurisation et sur un Cloud provider 

Et qu’est ce que Devoteam vous offre en échange?

  • Un CDI, pour se projeter ensemble sur le long terme

  • Un salaire attractif en lien avec votre expérience et les tendances du marché

  • Une base de travail en Ile de France et un accord télétravail permettant une meilleure flexibilité 

  • Des avantages comprenant mutuelle, prévoyance santé, CSE, mais aussi des compensations de vos frais internet et installations relatives au télétravail

  • Des challenges organisés tout au long de l’année avec de très jolis gains (voyages, matériels technologiques, accès à des événements….)

  • Un plan de carrière personnalisé avec des formations et certifications en lien avec votre trajectoire en bénéficiant des cursus, labs, formateurs du premier partenaire AWS en France

  • De multiples possibilités de mobilité, géographique mais aussi inter communauté, vous permettant d’évoluer en fonction de vos appétences technologiques ou métier mais aussi selon des projets plus personnels 

  • Un esprit de communauté fort autour de vos technologies de prédilection, au travers d’événements internes vous permettant d’interagir, célébrer et continuer d’apprendre

  • Une réelle possibilité de rayonner et partager vos connaissances et votre vision par le biais de conférences, meetups ou articles 

  • Plus de 30 clubs Happiness@Devoteam qui te permettent de partager et laisser libre cours à tes passions (running, art, football, musique, gastronomie, yoga, …)

Intéressé.e ????‍♀️????‍♂️?

N’attendez plus et postulez à l’offre!

La suite du process se déroulera en toute confidentialité et bienveillance: rencontre avec l’équipe Recrutement, Sales et managériale, avec au moins un rendez-vous en présentiel pour venir découvrir nos locaux et sentir de plus près la bonne humeur et l’énergie de nos équipes ????

Nous veillons à vous faire vivre des process de recrutement les plus dynamiques possibles et nous nous engageons à vous faire un retour sous 72h après chaque étape.

Le Groupe Devoteam oeuvre pour l'égalité des chances, pour la promotion de ses collaboratrices et de ses collaborateurs au mérite et lutte activement contre toute forme de discrimination. Nous sommes persuadés que la diversité contribue à la créativité, au dynamisme et à l'excellence de notre organisation.
Tous nos postes sont ouverts aux personnes en situation de handicap.

See more jobs at Devoteam

Apply for this job

14d

Architecte Cloud Hybride H/F - Innovative Tech

DevoteamLevallois-Perret, France, Remote
agileterraformansibleazurec++dockerkuberneteslinuxAWS

Devoteam is hiring a Remote Architecte Cloud Hybride H/F - Innovative Tech

Description du poste

Vos principales responsabilités en tant que Architecte Cloud Hybride

Voici une liste non exhaustive de vos missions au quotidien, nous vous faisons confiance pour les prendre en main et les enrichir à votre façon ????

La conception d’architectures multicloud et  Cloud Hybride 

  • Accompagner et effectuer des études de choix de solutions techniques en fonction des besoins de nos clients et au regard du marché IT

  • Concevoir, valider et participer à la mise en œuvre des architectures de Cloud Privé et de Cloud Hybride, basé sur les technologies (VMware, Azure, OVHcloud, AWS, GCP, Red Hat, Kubernetes, …)

  • Etablir les modes de consommation des services et la gestion du cycle de vie de ces derniers

  • Etablir les plans de continuité et de reprise des infrastructures, services et applications

  • Anticiper la gestion financière des infrastructures et des services mis en oeuvre et les impacts sur la gestion contractuelle 

  • Définir et participer à la rédaction des documents d'architecture (HLD, LLD, DEX) et de préconisations

  • Organiser et planifier des comités de validation des architectures, assurer un reporting hebdomadaire

  • Concevoir et valider les services d'infrastructures : outillage d'exploitation, système (serveurs et fermes mutualisées), données (stockage, sauvegarde), middleware, réseaux, sécurité…

Le déploiement des architectures cloud

  • Organiser et participer à la construction des socles techniques (gouvernance, landing zone, architecture de références, sécurité, réseau, finops,...)

  • Déployer et industrialiser les architectures cibles

  • Définir et proposer les modes de migration des applications

  • Veiller à la sécurité, la fiabilité et aux cycles de vie des environnements déployés

Où réaliserez-vous vos missions ? Chez des clients grands comptes de la banque, de l’assurance, de l’industrie, du retail de la Défense, du luxe ou encore de l’énergie, porteurs de projets innovants.

L’accompagnement et la formation

Pour réussir ce nouveau challenge My Devoteam Academy vous proposera des actions de formation et des certifications avec nos partenaires, mais aussi un système de parrainage et un dispositif d’évaluation personnel régulier, notamment :

  • Évoluer dans un environnement agile et ambitieux grâce au développement continu

  • S’intégrer dans les communautés technologiques 

  • Contribuer à améliorer la base de connaissances internes, les assets techniques existants et les supports de bonnes pratiques

  • Déployer votre esprit intrapreneur et créatif en identifiant des projets de transformation digitale auprès de nos clients (avant-vente, réponse à appel d’offres…).

Qualifications

Ce que vous apporterez à la Tribu ?

Diplômé.e d’une école d’ingénieurs ou d’un Master 2 en informatique, vous êtes doté.e d’un excellent relationnel, d’un sens prononcé du service et de la qualité. Vous aimez travailler en équipe, and vous parlez couramment français et anglais.

Vous avez minimum 5 années d’expériences professionnelles en tant qu’architecte IT et maitrisez  tout ou partie des technologies suivantes : 

  • conteneurisation (K8s, Docker, Swarm, Tanzu, OpenShift,...)

  • VMware (VSphere, VSAN, NSX, KVM)

  • Cloud (Azure, AWS, GCP, Alibaba Cloud et OVHcloud)

  • stockage (NAS/ SAN/ DAS) 

  • les architectures réseaux et télécoms

  • les outils tiers (Terraform, Ansible, Veeam, SCCM, PowerShell, …)

  • et vous avez un socle de connaissances confirmé en environnement Unix, Linux et/ou Windows Server. 

Vous souhaitez affirmer une trajectoire professionnelle vers des sujets d’automatisation d’infrastructure et de Cloud Privé ou hybride (AWS, Azure, GCP, OVH). Vous souhaitez développer votre sens critique en tant que consultant au regard des problématiques Cloud, des adhérences middlewares aux éléments sous-jacents des architectures du système d’information et des applications. 

[Cherry on the cake????]

Votre curiosité au sujet des risques liés à la sécurité des infrastructures virtuelles, des normes applicables (ANSSI, NIST, CIS,…) de cybersécurité serait un plus.

Et qu’est ce que Devoteam vous offre en échange?

  • Un CDI, pour se projeter ensemble sur le long terme

  • Un salaire attractif en lien avec votre expérience et les tendances du marché

  • Une base de travail en Ile de France et un accord télétravail permettant une meilleure flexibilité 

  • Des avantages comprenant mutuelle, prévoyance santé, CSE, mais aussi des compensations de vos frais internet et installations relatives au télétravail

  • Des challenges organisés tout au long de l’année avec de très jolis gains (voyages, matériels technologiques, accès à des événements….)

  • Un plan de carrière personnalisé avec des formations et certifications en lien avec votre trajectoire en bénéficiant des cursus, labs, formateurs du premier partenaire AWS en France

  • De multiples possibilités de mobilité, géographique mais aussi inter communauté, vous permettant d’évoluer en fonction de vos appétences technologiques ou métier mais aussi selon des projets plus personnels 

  • Un esprit de communauté fort autour de vos technologies de prédilection, au travers d’événements internes vous permettant d’interagir, célébrer et continuer d’apprendre

  • Une réelle possibilité de rayonner et partager vos connaissances et votre vision par le biais de conférences, meetups ou articles 

  • Plus de 30 clubs Happiness@Devoteam qui te permettent de partager et laisser libre cours à tes passions (running, art, football, musique, gastronomie, yoga, …)

Intéressé.e ????‍♀️????‍♂️?

N’attendez plus et postulez à l’offre!

La suite du process se déroulera en toute confidentialité et bienveillance: rencontre avec l’équipe Recrutement, Sales et managériale, avec au moins un rendez-vous en présentiel pour venir découvrir nos locaux et sentir de plus près la bonne humeur et l’énergie de nos équipes ????

Nous veillons à vous faire vivre des process de recrutement les plus dynamiques possibles et nous engageons à vous faire un retour sous 72h après chaque étape.

Le Groupe Devoteam oeuvre pour l'égalité des chances, pour la promotion de ses collaboratrices et de ses collaborateurs au mérite et lutte activement contre toute forme de discrimination. Nous sommes persuadés que la diversité contribue à la créativité, au dynamisme et à l'excellence de notre organisation.
Tous nos postes sont ouverts aux personnes en situation de handicap.

See more jobs at Devoteam

Apply for this job

15d

Senior Software Engineer (Elastic Path, AWS, Java, Python)

Pure IntegrationPhiladelphia, PA, Remote
Bachelor's degreeDesignjavapythonAWSbackend

Pure Integration is hiring a Remote Senior Software Engineer (Elastic Path, AWS, Java, Python)

Job Description

We are seeking a Senior Software Engineer (Elastic Path, AWS, Java, Python) to join our growing team. You will be responsible for designing, developing, and maintaining our backend systems using Java, Python, and Spring and SOAP frameworks. Your work will directly impact our client’s ability to deliver high-quality products and services to our customers. Our ideal candidate will possess extensive experience in software application utilizing Java and Spring and will have the ability to quickly pick up new languages and technologies as needed. If you are a creative problem solver, enjoy translating high-level requirements into actionable solutions, and enjoy a fast-paced, dynamic environment, this could be the perfect opportunity for you.

This position is a hybrid position with 4 days on-site and 1 day remote and will be a W-2 Hourly 3-monthcontract with possible extension. Exceptional remote candidates will be considered.

The hourly rate is $70/hr.  – $74/hr. Candidates will be paid within this range based on their work experience and skills. Candidates are also eligible for limited benefits such as health insurance, professional development, trainings, our referral bonus program, and our wellness program.

Responsibilities:

  • Codes software applications to adhere to designs supporting internal business requirements or external customers.
  • Standardizes the quality assurance procedure for software.
  • Monitors and maintains operational readiness of Middleware Applications, including applications hosted in AWS cloud.
  • Identifies opportunities for system enhancements that will deliver enhanced functionality and/or simplify system administration.
  • Facilitates and develops plans for application changes (including defects fixes, enhancements and/or configuration changes).
  • Configures and tests changes to system including reports, security access, and workflow.
  • Performs/Coordinates configuration changes to the production environment.
  • Works closely with BA/QA team members to create test plans and ensure that issues are properly identified, fixed, and tested.

Qualifications

  • Requires a Bachelor's degree in computer science, or a related field.
  • 7 years of experience working to mentor and coach other team members on coding practices, design principles, and implementation patterns that lead to high-quality maintainable solutions.
  • Expert-level implementation skills with Elastic Path versions 7.x and 8.x.
  • Strong understanding of AWS Cloud platforms including VPCs, Security Groups, and Lambdas. 
  • Expert-level implementation skills with the Core Spring Framework and including other sub-projects like Spring JMS, Spring Security, Spring Data and Spring Integration.
  • Skilled at building modern REST Web services.
  • Experience with additional scripting languages such as Python is a plus.
  • Experience consuming API/web-based services.

See more jobs at Pure Integration

Apply for this job

15d

Senior Software Engineer II

FlywireUSA Remote, US, Remote
Designmongodbhtml5javaelasticsearchmysqllinuxAWSjavascript

Flywire is hiring a Remote Senior Software Engineer II

Job Description

The Opportunity:

We, at Flywire, are looking for an experienced Sr. Software Engineer II, ideally with a background in FinTech. Your primary responsibility will be to build and maintain the platform that supports the money movement of our industry leading payment engine moving hundreds of millions everyday. 

You will be joining a team in charge of designing new functionalities and improving the current capabilities to improve speed, cost and scalability of our product. Thus, a commitment to collaborative problem solving, pragmatic design, building quality products and to convey the sensation that the product is the responsibility of all the team is essential. You will be responsible for ensuring high quality code in a team defined timeframe. 

  • Write clean, high quality, testable, secure, maintainable and extendable code
  • Solve items such as challenging bugs and production issues within the development environment
  • Work on complex issues where analysis of situations or data requires an in-depth evaluation of variable factors.
  • Exercise judgment in selecting methods, techniques and evaluation criteria for obtaining results
  • Understand scalability and performance status and make improvement for scalability
  • Drive change and improvement in all phases of the development lifecycle
  • Partake in the recruitment process by identifying and exciting great talent
  • Ensure the best possible performance, quality, and responsiveness of the applications
  • Contribute to the product vision by collaborating with Product Managers and stakeholders
  • Drive initiatives to lead projects as well as mentor team members

Qualifications

Here’s What We’re Looking For:

  • 8+ years of experience in Java
  • Experience in designing, developing and supporting scalable, performant and reliable web applications and distributed systems
  • Seasoned in techniques such TDD and BDD
  • Proficient working with continuous integration and delivery (CI/CD)
  • Understanding of relational databases 
  • Strong understanding of object-oriented fundamentals
  • Great understanding of the other disciplines in the cross functional team: QAs, Product and SREs
  • Outstanding verbal and written communication skills and the ability to collaborate with cross functional teams including product and support 
  • Experience in FinTech or the payment industry will be appreciated
  • The ability to deliver high quality code and learn quickly

Technologies We Use:

  • Java 
  • React
  • JavaScript, HTML5, and CSS3 
  • System management: Linux, MySQL, MongoDB, Redis, Sidekiq, AMQP, ElasticSearch,
  • Machine Learning
  • Cloud platform: AWS

See more jobs at Flywire

Apply for this job

15d

Senior Software Engineer (Hybrid/Remote)

Oasis Africa Consulting LimitedJakande, Lekki, Nigeria, Remote
agileDesignhtml5scrumapiqagittypescriptAWSjavascriptbackendNode.js

Oasis Africa Consulting Limited is hiring a Remote Senior Software Engineer (Hybrid/Remote)

Job Description

 

Desired Abilities- Ability to:

Design, develop, and maintain high-quality, scalable, and secure software solutions using Node.js, TypeScript, and AWS technologies.

Collaborate with cross-functional teams, including product management, UX/UI design, and QA, to gather requirements, define specifications, and ensure the successful delivery of projects.

Architect and implement efficient, maintainable, and modular code in javascript and Typescript, adhering to best practices, coding standards, and established guidelines.

Optimise application performance by identifying bottlenecks, implementing solutions, and conducting regular code reviews.

Leverage AWS services and tools to design and implement cloud-native applications, ensuring optimal performance, security, and cost-effectiveness.

Participate in the entire software development lifecycle, from planning and design to deployment and maintenance, ensuring smooth project execution.

Stay up-to-date with industry trends, emerging technologies, and best practices in software engineering, particularly within the Node.js, TypeScript, and AWS ecosystems.

Troubleshoot, diagnose, and resolve software issues, providing timely and practical solutions to ensure minimal user disruption.

Collaborate with the other engineering team members to ensure smooth CI/CD pipelines, infrastructure management, and monitoring and alerting systems.

 

You could be an ideal match if you possess:

4+ years of professional experience in software development, focusing on web applications and backend services using JavaScript, TypeScript, and Node.js. You will need to have strong proficiency in JavaScript, TypeScript, and Node.js with a deep understanding of core concepts, asynchronous programming, and performance optimisation techniques.

2+ years of experience working with front-end frameworks, preferably Vue.js - and a solid understanding of HTML5, CSS3, and related web technologies - in building user-friendly and responsive web applications.

Familiarity with Agile development methodologies, such as Scrum or Kanban, and experience working in an Agile environment.

Some experience with NestJS, a progressive Node.js framework, and familiarity with its underlying principles, such as dependency injection and modularity, is a plus.

Knowledge of Domain-Driven Design (DDD) concepts and experience implementing DDD principles in software projects is valuable.

Familiarity with AWS services such as EC2, S3, Lambda, API Gateway, RDS, and Load balancers, and experience building scalable and secure cloud-based applications.

Knowledge of RESTful API design principles.

Experience with version control systems, preferably Git, and understanding of best code management and collaboration practices.

Proficiency in writing and maintaining unit, integration, and end-to-end tests using testing frameworks such as Jest, Mocha, or Jasmine.

Good knowledge of software development best practices, including design patterns, code modularity, and maintainability.

Strong problem-solving skills, with the ability to analyse complex issues, develop practical solutions, and adapt to changing requirements.

Excellent communication and collaboration skills, with the ability to work effectively in a team-oriented environment.

Qualifications

 

An engineering degree is not a prerequisite; instead, we highly value relevant experience in software development and a demonstrable portfolio of projects that highlight your skills.

See more jobs at Oasis Africa Consulting Limited

Apply for this job

16d

AWS Engineer

Atlas TechnicaNY, US Remote
1 year of experience4 years of experienceDesignAWS

Atlas Technica is hiring a Remote AWS Engineer

Position Name: AWS Engineer
Reports to: Support Manager
Location/Type: Remote
Status: Non-Exempt

Atlas Technica's mission is to shoulder IT management, user support, and cybersecurity for our clients, who are hedge funds and other investment firms. Founded in 2016, we have grown 100% year over year through our uncompromising focus on service. 

We value ownership, execution, growth, intelligence, and camaraderie. We are looking for people who share our Core Values, thrive, and contribute to this environment while putting the customer first. At Atlas Technica, we offer a competitive salary, comprehensive benefits, and great perks to our global Team. We strive to maintain a professional yet friendly environment while promoting professional and career development for our Team Members. Join Atlas Technica now!

We are seeking an individual with experience in AWS to join our Service team. The goal of this team is to design, implement and support public cloud solutions for our customers.

Responsibilities

  • Design, implement and support public cloud solutions for our customers
  • Work with a mixture of traditional services such as virtual machines and serverless or platform as a service products to deliver custom solutions to business problems
  • Provide technical guidance and support to junior team members and stakeholders on AWS-related matters
  • Research and development of new solutions, implement of established solutions according to best practice/documentation, create documentation of the solutions, and provide second-line support for these solutions

Qualifications

  • 2+ years of AWS experience
  • Experience with EC2, S3, RDS, VPC, and IAM for high availability, security, and performance.
  • Experience with AWS Organizations, IAM Identity Center and Control Tower managing multiple accounts under single organization.
  • Experience implementing networks and connectivity, specifically connectivity between physical and cloud networks (VPNs, etc.).
  • Experience working with development, operations, and security teams to integrate AWS solutions into existing workflows and processes.
  • 1 year of experience with an automation language such as PowerShell or Python.
  • Drive, willingness to learn, responsibility for one’s own work and the overall outcome.
  • Ability to communicate complex technical information to different audiences.
  • Active certifications in AWS. Must be at least Associate level. Active certification is a requirement.

Desirable Qualities

  • Experience with working with clients in finance or alternative investment industries.
  • Experience with infrastructure such as code technologies and CI/DC technologies.
  • Experience with automation scripts and tools for provisioning, configuration, and monitoring of AWS resources.
  • Experience with writing technical documentation
  • 2-4 years of experience at a Managed Services Provider.

See more jobs at Atlas Technica

Apply for this job

16d

Senior Java Developer, CWAF Group

ImpervaHybrid Remote, Rehovot, Israel
DesignjavaAWSbackend

Imperva is hiring a Remote Senior Java Developer, CWAF Group

Imperva is a multi-billion-dollar cybersecurity company, that protects the world’s largest organizations from cyber-attacks. We work in a Hybrid Model from home and from the office (Rehovot) and We have been recognized as one of the Best 50 high-tech companies to work for in Israel 2023 by Dun & Bradstreet!Duns10-Imperva

We are looking for a Senior Java developer to join the Cloud WAF R&D group. The team develops cloud-based solutions to manage and optimize the website protection orchestration. Imperva Cloud WAF (Web Application Firewall) is a key component of Imperva’s offering, providing enterprise-class protection against the most sophisticated security threats.  
If you are passionate about building a large scale service with delightful user experiences, excited about security and ready to fight cybercrime, able to learn and then demonstrate a deep understanding of backend and Cloud technologies, come join us - together we can make a worldwide impact!  
   
 
       
 
          
Requirements:   
  • B.SC in Computer Science or equivalent
  • At least 6-years experience in backend/java development. 
  • Proven experience with designing large-scale complex features, design patterns and distributed software architecture
  • Experience with cloud technologies such as AWS
  • Spring Boot application and containerization, K8S - an advantage
  • Natural leader who excels at coaching and mentoring
  • Highly self-motivated person, fast learner and independent
  • “Can do” attitude with strong interpersonal and communication skills
   
   
 
   Key Responsibilities:   
  • Plan, Design, develop, test and deploy distributed, highly available, scalable microservices
  • Performing code reviews, design reviews, write and execute high quality code with unit/component/contract tests
  • Demonstrating a broad set of technology skills in backend technologies that can be used to set high standards for developers
    
Legal Notice:

Imperva is an equal-opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, national origin, ancestry, pregnancy, age, sexual orientation, gender identity, marital status, protected veteran status, medical condition or disability, or any other characteristic protected by law.   
   
       
#LI-OK1   
  

See more jobs at Imperva

Apply for this job

16d

Senior Machine Learning Engineer

Logic20/20 Inc.San Francisco, CA, Remote
agileterraformsqlDesignpythonAWS

Logic20/20 Inc. is hiring a Remote Senior Machine Learning Engineer

Job Description

Logic20/20 is seeking a Machine Learning Engineer to lead data science teams that are utilizing artificial intelligence and machine learning to predict and analyze computer vision or customer intent models. This is an exciting opportunity to make an impact by leveraging AI and ML techniques to create production-level systems through the application of machine learning models.  

What you’ll do:

  • Create frameworks to predict a variety of outcomes in different scenarios 
  • Create models of customer satisfaction that provide detailed insight into what causes a customer to take different actions 
  • Configure a multi-account MLOps environment
  • Collaborate with other data scientists and stakeholders on projects 
  • Research and design statistical models to answer target questions, optimize processes and outcomes, and inform decision-making 
  • Develop solutions in R or Python 
  • Develop production-grade solutions 
  • Work in Hadoop, Redshift, and Spark 
  • Translate business and product questions into analytics projects 
  • Communicate clearly over written and oral channels while translating complex methodologies and analytical results into high-level insights 

Qualifications

Must have:

  • 5+ years of experience in machine learning with a focus on MLOps
  • 3+ years of AWS experience: AWS SageMaker, AWS Glue, etc.
  • 5+ years of experience with R or Python, SQL
  • Strong experience with Terraform
  • Experience building and managing CI/CD pipelines
  • Familiarity with popular machine learning libraries and frameworks, including TensorFlow, Keras, etc. 
  • Experience working in an Agile environment
  • Knowledge of professional enterprise software development and practices including software lifecycle, best coding practices, version control, architecture, testing and deployment 

Preferred:

  • Master's degree/PhD in computer science or related field 
  • Experience with AWS Rekognition, AWS Lake Formation, AWS Ground Truth
  • Experience with TensorFlow
  • Experience with PyTorch and/or PySpark

See more jobs at Logic20/20 Inc.

Apply for this job