javascript Remote Jobs

832 Results

6d

Développeur / Développeuse Frontend React - niveau sénior

XplorVilleneuve-d'Ascq, France, Remote
agilejiraqatypescriptjenkinsjavascriptbackendfrontend

Xplor is hiring a Remote Développeur / Développeuse Frontend React - niveau sénior

Description du poste

Tu rejoindras Xplor en tant que Développeur / Développeuse sénior Frontend React à Villeneuve d'Ascq au sein de l’équipe Engineering, afin de participer à l’évolution du produit Xplor Resamania dont le développement a démarré en 2016.

Xplor Resamania est notre logiciel de gestion d'entreprise tout-en-un pour les clubs de fitness et de remise en forme. Intuitif et flexible, il intègre le paiement, le contrôle d'accès, la gestion des membres, la vente, la gestion des abonnements, le planning, l'automatisation du marketing, le reporting,...

Rattaché(e) au lead développeur tes missions principales seront de :

  • Développer sur un produit "multi-projets", en collaboration avec les autres équipes (backend, QA, produit ...)
  • Participer aux phases de conception des features
  • Participer activement aux ateliers techniques, aux codes reviews, ...
  • Participer au maintien et à l'évolution de la stack technique
  • Réaliser des tests automatisés
  • Garantir la maintenance évolutive durant les phases de Run
  • Participer aux ateliers méthodologiques et être force de proposition.

Environnement technique : 

  • React 17 (hooks, functional components, ...)
  • Gestion d'état standard (state React + context) + utilisation d'un hook inspiré de TanStack Query
  • 50% de code Javascript, 50% de code Typescript 4.7
  • MUI4 et MUI5
  • Méthodologie Agile (Features teams)
  • Couverture CI (Travis), linters, déploiement avec Jenkins
  • Jira, Github, MS365 …

Qualifications

De formation bac + 2 minimum, tu disposes d’un diplôme dans le secteur de l’informatique. Tu es organisé(e), autonome, tu aimes travailler en équipe et tu disposes d’une forte capacité d’analyse. Ta curiosité te pousse à comprendre comment fonctionne un logiciel : nous cherchons autant des compétences techniques que d’une appétence pour le métier et les aspects fonctionnels de l’application.

Qu'est-ce qui ferait de moi un bon candidat ou une bonne candidate ?

  • une expérience similaire de 5 à 6 ans
  • une forte autonomie dans le travail personnel
  • une bonne capacité à travailler en équipe autant en remote qu’en présentiel (tu travailleras avec plusieurs Devs Back)
  • une bonne capacité à réfléchir à une problématique abstraite et en déduire la réponse la plus pertinente
  • une solide expérience sur l'utilisation de MUI, TanStack Query, ou une capacité à apprendre rapidement

See more jobs at Xplor

Apply for this job

6d

Développeur / Développeuse Frontend React - niveau intermédiaire

XplorLille, France, Remote
agilejiraqatypescriptjenkinsjavascriptbackendfrontend

Xplor is hiring a Remote Développeur / Développeuse Frontend React - niveau intermédiaire

Description du poste

Tu rejoindras Xplor en tant que Développeur / Développeuse Frontend React à Villeneuve d'Ascq au sein de l’équipe Engineering, afin de participer à l’évolution du produit Xplor Resamania dont le développement a démarré en 2016.

Xplor Resamania est notre logiciel de gestion d'entreprise tout-en-un pour les clubs de fitness et de remise en forme. Intuitif et flexible, il intègre le paiement, le contrôle d'accès, la gestion des membres, la vente, la gestion des abonnements, le planning, l'automatisation du marketing, le reporting,...

Rattaché(e) au lead développeur tes missions principales seront de :

  • Développer sur un produit "multi-projets", en collaboration avec les autres équipes (backend, QA, produit ...)
  • Participer aux phases de conception des features
  • Participer activement aux ateliers techniques, aux codes reviews, ...
  • Participer au maintien et à l'évolution de la stack technique
  • Réaliser des tests automatisés
  • Garantir la maintenance évolutive durant les phases de Run
  • Participer aux ateliers méthodologiques et être force de proposition.

Environnement technique : 

  • React 17 (hooks, functional components, ...)
  • Gestion d'état standard (state React + context) + utilisation d'un hook inspiré de TanStack Query
  • 50% de code Javascript, 50% de code Typescript 4.7
  • MUI4 et MUI5
  • Méthodologie Agile (Features teams)
  • Couverture CI (Travis), linters, déploiement avec Jenkins
  • Jira, Github, MS365 …

Qualifications

De formation bac + 2 minimum, tu disposes d’un diplôme dans le secteur de l’informatique. Tu es organisé(e), autonome, tu aimes travailler en équipe et tu disposes d’une forte capacité d’analyse. Ta curiosité te pousse à comprendre comment fonctionne un logiciel : nous cherchons autant des compétences techniques que d’une appétence pour le métier et les aspects fonctionnels de l’application.

Qu'est-ce qui ferait de moi un bon candidat ou une bonne candidate ?

  • une expérience similaire de 2 à 4 ans
  • une forte autonomie dans le travail personnel
  • une bonne capacité à travailler en équipe autant en remote qu’en présentiel (tu travailleras avec plusieurs Devs Back)
  • une bonne capacité à réfléchir à une problématique abstraite et en déduire la réponse la plus pertinente
  • une première expérience sur l'utilisation de MUI, TanStack Query, ou une capacité à apprendre rapidement

See more jobs at Xplor

Apply for this job

7d

Technical Solutions Engineer

AristaKraków, Poland, Remote
javac++linuxpythonjavascript

Arista is hiring a Remote Technical Solutions Engineer

Job Description

Going far beyond the standard call center or tiered support position, the Technical Solutions
Engineer at Arista Networks is a top-level engineer, equivalent to a Tier 3 or Escalation Engineer in most support organizations.

The TSE works in a non-silo environment, supporting all of Arista’s products and the many network. protocols and features covered by EOS. They will work directly with both the customer and (when needed) the software and hardware development teams. The TSE team also performs all their own recreations in a dedicated lab environment.

Giving customers direct access to a high-level engineer streamlines the support process and raises customer satisfaction.

Responsibilities:
● Respond to customer product inquiries via telephone or email.
● Resolve customer concerns raised during installation, operation, maintenance or product
application or compatibility issues.
● Interpersonal skills and product knowledge and expertise are critical to responding to daily
customer-centric activities.
● Troubleshoot problems with hardware equipment and software applications and recommend
corrective action.
● Document customer communication and recurring technical issues to support product quality
programs and product development.

Qualifications

Required Product Knowledge and Technical Skills:
● Working knowledge of the networking industry, products, and protocols
● Minimum of 3+ years of hands-on experience and a combination of the designing, deploying, configuring, supporting, troubleshooting, debugging and administering of the following network protocols and technologies:
○ AAA/RADIUS/TACACS, ACL, ARP, BGP (RFC 4271), DHCP, 1G/10G Ethernet (IEEE
802.3ab & IEEE 802.3ae) and other higher speed Ethernet interfaces, EVPN, IEEE 802.3x flow control and IEEE 802.1Qbb priority-based flow control, ICMP, IGMP, IPSec, IPv4 & IPv6, LACP, LLDP, MACSec, MPLS, NAT, OpenFlow, OSPFv2 and OSPFv3, PIM, QoS, Sflow, SNMP, STP/RSTP/MST (IEEE 802.1D), VARP, VRRP, VLAN (IEEE 802.1Q), VRF, VXLAN

● Experience with troubleshooting tools such as IXIA, tcpdump, and Wireshark (or similar
packet generation and analysis tools) is highly desired
● A strong comfort level with Linux is highly desired
● Familiarity with programming/scripting (C++, Java, Python, Perl, JavaScript, shell)/ Cloud
Environment/Automation a plus

Desired skills:
The ideal candidate possesses the ability to troubleshoot complex and dynamic customer
environments while balancing the communications needs of each case. A strong analytical mind is required, as is the ability to triage. As we are continually releasing new features and products, a high aptitude for both learning and teaching are required.
Our engineers work closely with other members of Customer Engineering as well as both Software and Hardware development – both in diagnosing problems as well as communicating them in multiple technical contexts. Thus, excellent written and verbal communication skills are a must, as is a collaborative approach.

Education:
Minimum education is a B.S or ideally an MS in a technical field (CS/EE preferred) or related.
Industry certifications are preferred. Prior TAC experience preferred.

Apply for this job

7d

Software Support Engineer (Second Shift)

LaserficheRemote States, United States
c++linuxpythonAWSjavascript

Laserfiche is hiring a Remote Software Support Engineer (Second Shift)

Description

Do you thrive in a fast-paced environment using your expertise and creativity to solve problems for people? Do you want to work in a growing organization supporting people on software that's used—and loved—by organizations around the world? Are you an afternoon/evening person that enjoys working a 2nd shift schedule? If so, we may be looking for you to join our Product and Customer Support team!
 
As a Software Support Engineer, you will be communicating with our Solution Providers and customers in a variety of industries—such as financial services, government, and education—and working with them to address any type of issue that arises from using Laserfiche software in both SaaS and self-hosted environments. Additionally, you will help expedite issue resolution, and enhance our DevOps processes for our fast-growing SaaS system. As part of our 24/7 support team, you will also help maintain our cloud system, provide post-issue analysis, and serve as a program resource for delivering SLAs that impact system availability, scalability, reliability, and security for our SaaS cloud service. If you have strong technical skills and enjoy tackling challenging support cases through problem-solving and effective communications, come join our team!
 
Eligible States for Remote Work: Arizona, California, Florida, Georgia, Hawaii, Maryland, Massachusetts, Minnesota, Nevada, Ohio, Oregon, Texas, Virginia, Washington, Washington DC, West Virginia and Wisconsin
 
#LI-Remote
#LI-Hybrid
 

About the Role - Essential Functions                                   
  • Work with Solution Providers and customers to provide technical support by identifying, troubleshooting, resolving, and documenting Laserfiche technical issues
  • Use third party or Laserfiche tools to check Laserfiche Cloud system diagnostics, investigate system performance issues, monitor availability, and document issues as appropriate
  • Facilitate timely and relevant communication of escalated incidents to impacted stakeholders
  • Engage in post-issue analysis to examine incident response performance, identify areas for service improvement, and monitor progress of implementing recommendations
  • Work with software engineering teams to troubleshoot more complex issues
  • Collaborate with software engineering teams to refine in-application diagnostics (e.g., error logging and reporting) and consolidate data across cloud-based services
  • Develop strong working relationships with Solution Providers, customers and Laserfiche teams

 

About You - Essential Qualifications
  • 4-year degree (BA, BS) required or equivalent industry experience
  • Must be able to work the second shift schedule (3:00 PM to 12:00 AM US Pacific Time)
  • Preferably experienced and certified at working with AWS
  • Experienced in systems troubleshooting, including database systems, TCP/IP-based networking, web applications, and Windows and Linux system administration
  • Preferably skilled at scripting/programming in one or more of the following: PowerShell, Bash, Python, C#, JavaScript, and Ruby.
  • 2-5 years of software support experience in a customer facing role, and working with ticketing systems
  • Exceptional problem-solving, analytical, communication and customer service skills
  • Ability to learn quickly and adapt to changing environments
  • Ability to communicate in Spanish is a plus
The salary range varies, and pay is based on several factors including but not limited to education, certifications (if applicable), candidate's geographic region, job-related knowledge, skills, and years of experience among other factors.                                
  • Range: $60,000 - $75,000 plus a 5% shift premium for second shift hours
                                     
Perks & Benefits at a Glance                                  
  • Generous time off:
    • 15 Days of Vacation
    • 3 Floating Holidays
    • 2 Paid Volunteer Days
    • 9 Paid Holidays
    • 4-day Year-end Closure
  • Hybrid Work Environment
  • Free Parking: covered and EV charging stations
  • Various 401 (k) Investment Options and Generous Company Match
  • HMO and PPO Medical Care Options (Employees are fully covered under HMO)

About Us
Laserfiche is the leading global provider of intelligent content management and business process automation. The Laserfiche® platform enables organizations in more than 80 countries to transform into digital businesses. Customers in every industry—including government, education, financial services, and manufacturing—use Laserfiche® to boost productivity, scale their business and deliver digital-first customer experiences. Our employees in offices around the world are committed to the company’s vision of empowering customers and inspiring people to reimagine how technology can transform lives.
 
Learn more about our team here

Laserfiche complies with all Equal Opportunity and Affirmative Action regulations. Laserfiche makes all employment decisions – such as recruiting, hiring, training, promotion, compensation, professional development practices, discipline and termination – without regard to race, religion, color, national origin, ancestry, citizenship, sex, pregnancy, age, creed, physical or mental disability, medical condition, genetic characteristic, marital status, veteran status, gender identity/expression, sexual orientation or any other characteristic protected by law, except as may be permitted by law.                                  
                              
Laserfiche provides reasonable accommodations for applicants with disabilities upon request. For more information please contact Talent Acquisition at https://www.laserfiche.com/contact/ or 562-988-1688.   

See more jobs at Laserfiche

Apply for this job

7d

Embedded Escalation Engineer (EEE) - COSMOSDB - (GS)

ITScoutLATAM, AR Remote
agilescalanosqlsqlDesignmobileazurejavac++.netpythonjavascript

ITScout is hiring a Remote Embedded Escalation Engineer (EEE) - COSMOSDB - (GS)

⚠️Only available for #residents of #Latinamerica⚠️


Our client builds smart technology solutions through the combination of artificial intelligence, mobile, and web development for companies in the United States, Canada & Latam. It´s a technology company headquartered in Costa Rica. With operations throughout LATAM. Their core focus is building intelligent tech solutions to help our customers be more efficient in optimizing internal digital processes.

About the job Embedded Escalation Engineer (EEE) - COSMOSDB

Overview

Interested in being on the cutting edge of Cloud Services helping build a NoSQL database service with limitless elastic scale? Then come join us as an Embedded Escalation Engineer (EEE) working with Azure Cosmos DB. This is a great opportunity to be part of a diverse, inclusive, agile team and have high impact.

Key Responsibilities:

As an Embedded Escalation Engineer (EEE), You will have the following key responsibilities:

  • Lead engineering investigations to bring quicker issue resolution to support incidents impacting our customers and improve customer experience.
  • Build solutions, help create tools, help automate issue detection and diagnosis, to enable customers or support to self-resolve the issues.
  • Identify emerging trends or re-occurring escalation scenarios and drive engineering opportunities to mitigate and/or eliminate them from the workflow. This can include a range of potential work item categories; such as self-healing mechanisms, self-serve, transparency, automation, and/or increasing the capabilities for Azure support.
  • Contribute to product improvements by filing impactful bugs, design change requests and helping developers to fix and ship them to production, preventing customers from being impacted.
  • As a trusted advisor to the Microsoft Azure engineering team and the Serviceability Technology Lead, you will suggest changes to future versions to better equip our support teams as well as our partners and customers and help influence in-market solutions today.
  • As a customer ambassador, you will also partner with engineering leadership for strategic technical, architectural and design discussions, and drive strategic thought leadership for Azure Diagnostics tools creation and usage worldwide bringing the customer voice to the center of impactful decisions. These strategic areas of focus will target our highest impact pain points for our partners, customers and team members.
  • Able to work well in challenging situations while exhibiting flexibility and ability tolerate and manage through ambiguity and uncertainty.
  • Beyond extensive technical and product focus, this role requires the ability to frame and communicate issues and recommendations clearly and concisely, show exceptional attention to detail, and demonstrate the ability to build broad relationships with the right influencers, leveraging those relationships to impact key business results.

Required Qualifications:

  • 3+ years of experience in a customer-facing or support role in any of the following: technical escalation support, product support, developer support, IT DevOps, IT Admin/support, Systems Development, or Consulting or IT/Network Operations.
  • 2+ years of experience in one or more of the following:
    • Previous experience working with NoSQL
    • Experience with Hadoop or another Big Data/Analytics technology
  • Microsoft Azure Platform:
    • Cloud Computing
    • Microsoft Azure architecture and its components (Fabric, Compute, Storage, RDOS, Management Portal)
  • Microsoft Big Data services
    • Java, JavaScript, Python, R, Scala, REST concepts, C/C++ and debugging
  • Familiarity with development: tools, language, process, methods, troubleshooting
  • Experience with Data Integration solutions and services
  • Experience with Open Source technology preferred
  • Development/Coding:
    • Experience with C#, JAVA, .NET, PowerShell, CLI, Microsoft Azure SQL
    • Service engineering and/or DevOps experience at internet scale involving user data and/or software development for an enterprise level product.
  • Superior problem solving and troubleshooting skills, an ability to use various data collection tools and methodologies to analyze problems and develop solutions
  • Excellent spoken and written English

Preferred Qualifications:

  • Experience in a Tier 2/3 environment is preferred.
  • BS in computer science or engineering or equivalent industry experience is preferred..

Soft Skills:

  • Passion for technology and customer supportability.
  • Leadership - handle technically challenging and politically hot customer situations.
  • Strong communications skills - excellent spoken and written English communication skills and the ability to present complex technical issues clearly and concisely to a general audience.
  • Ability to drive meetings and discussions remotely with authority.
  • Ability to develop and nurture relationships over long distances and remote technologies like Skype.
  • Ability to partner within virtual teams and execute multiple technical initiatives simultaneously.
  • Ability to work collaboratively with the Engineering teams to drive architectural changes to improve stability of environments.
  • Ability to prioritize core role responsibilities vs. other work requests received.
  • Logical and critical thinking.
  • Ability to deal with ambiguity under continual deadline constraints.


See more jobs at ITScout

Apply for this job

7d

Software Engineer II, Full-stack - Web Platform

SamsaraCanada - Remote
Bachelor's degreeDesigngraphqlgittypescriptjavascriptfrontend

Samsara is hiring a Remote Software Engineer II, Full-stack - Web Platform

Who we are

Samsara (NYSE: IOT) is the pioneer of the Connected Operations™ Cloud, which is a platform that enables organizations that depend on physical operations to harness Internet of Things (IoT) data to develop actionable insights and improve their operations. At Samsara, we are helping improve the safety, efficiency and sustainability of the physical operations that power our global economy. Representing more than 40% of global GDP, these industries are the infrastructure of our planet, including agriculture, construction, field services, transportation, and manufacturing — and we are excited to help digitally transform their operations at scale.

Working at Samsara means you’ll help define the future of physical operations and be on a team that’s shaping an exciting array of product solutions, including Video-Based Safety, Vehicle Telematics, Apps and Driver Workflows, Equipment Monitoring, and Site Visibility. As part of a recently public company, you’ll have the autonomy and support to make an impact as we build for the long term. 

Recent awards we’ve won include:

Glassdoor's Best Places to Work 2024

Best Places to Work by Built In 2024

Great Place To Work Certified™ 2023

Fast Company's Best Workplaces for Innovators 2023

Financial Times The Americas’ Fastest Growing Companies 2023

We see a profound opportunity for data to improve the safety, efficiency, and sustainability of operations, and hope you consider joining us on this exciting journey. 

Click hereto learn more about Samsara's cultural philosophy.

About the role:

Samsara is hiring a full-stack developer for the Web Platform team. The charter of the team is to accelerate feature development within Samsara’s web product by maintaining a high-quality frontend developer experience, owning common frameworks, shepherding/up-leveling our Design System, ensuring overall frontend health, and building a small set of features that cross-team boundaries.

Our team is currently staffed with several senior engineers along with one staff engineer. There are plenty of experienced folks to learn from. We’re looking for an experienced full-stack engineer who has a strong interest in front-end development to come join us!

You should apply if:

  • You want to impact the industries that run our world: The software, firmware, and hardware you build will result in real-world impact—helping to keep the lights on, get food into grocery stores, and most importantly, ensure workers return home safely.
  • You want to build for scale: With over 2.3 million IoT devices deployed to our global customers, you will work on a range of new and mature technologies driving scalable innovation for customers across industries driving the world's physical operations.
  • You are a life-long learner: We have ambitious goals. Every Samsarian has a growth mindset as we work with a wide range of technologies, challenges, and customers that push us to learn on the go.
  • You believe customers are more than a number:Samsara engineers enjoy a rare closeness to the end user and you will have the opportunity to participate in customer interviews, collaborate with customer success and product managers, and use metrics to ensure our work is translating into better customer outcomes.
  • You are a team player: Working on our Samsara Engineering teams requires a mix of independent effort and collaboration. Motivated by our mission, we’re all racing toward our connected operations vision, and we intend to win—together.

Click hereto learn about what we value at Samsara. 

In this role, you will: 

  • Solve complex problems and own the success of your solutions as you architect, build, test, and deliver full-stack products
  • Communicate, collaborate, and develop with engineers, other platform teams, product teams, product managers, designers, and support teams
  • Build upon skills and knowledge across a range of technologies such as Go, GraphQL, Typescript, React, and MySQL. Due to the nature of the role, previous experience with React is required, but experience with the other technologies is not required
  • Own the operational health of production systems as we build for the future scale of an ever-growing customer base
  • Make an impact on our core architecture, roadmap, and the wider engineering community
  • Champion, role model, and embed Samsara’s cultural principles (Focus on Customer Success, Build for the Long Term, Adopt a Growth Mindset, Be Inclusive, Win as a Team) as we scale globally and across new offices

Minimum requirements for the role:

  • You have at least a Bachelor's degree in Computer Science or similar, or corresponding level of relevant education
  • You have 2+ years of experience working professionally with modern development practices
  • You have knowledge of designing, architecting, and developing applications using modern JavaScript technologies like React and Typescript
  • Experience working with Designers, PMs, and other developers to ship E2E features to production environments
  • At this time we are only looking for candidates in Canada

An ideal candidate also has:

  • Experience building and maintaining a performant and responsive design system
  • Understanding and interest for building and maintaining large applications as well as extensible libraries/frameworks/APIs
  • Strong familiarity of web accessibility
  • Experience with packaging systems (Webpack, Rollup, etc.), frontend testing frameworks (Jest, Enzyme, etc.), linting tools (ESLint, Prettier, etc.), Git, and Storybook

Samsara’s Compensation Philosophy:Samsara’s compensation program is designed to deliver Total Direct Compensation (based on role, level, and geography) that is at or above market. We do this through our base salary + bonus/variable + restricted stock unit awards (RSUs) for eligible roles.  For eligible roles, a new hire RSU award may be awarded at the time of hire, and additional RSU refresh grants may be awarded annually. 

We pay for performance, and top performers in eligible roles may receive above-market equity refresh awards which allow employees to achieve higher market positioning.

The range of annual base salary for full-time employees for this position is below. Please note that base pay offered may vary depending on factors including your city of residence, job-related knowledge, skills, and experience.
$99,875$129,250 CAD

At Samsara, we welcome everyone regardless of their background. All qualified applicants will receive consideration for employment without regard to race, color, religion, national origin, sex, gender, gender identity, sexual orientation, protected veteran status, disability, age, and other characteristics protected by law. We depend on the unique approaches of our team members to help us solve complex problems. We are committed to increasing diversity across our team and ensuring that Samsara is a place where people from all backgrounds can make an impact.

Benefits

Full time employees receive a competitive total compensation package along with employee-led remote and flexible working, health benefits, Samsara for Good charity fund, and much, much more. Take a look at our Benefits site to learn more.

Accommodations 

Samsara is an inclusive work environment, and we are committed to ensuring equal opportunity in employment for qualified persons with disabilities. Please email accessibleinterviewing@samsara.com or click hereif you require any reasonable accommodations throughout the recruiting process.

Flexible Working 

At Samsara, we embrace a flexible working model that caters to the diverse needs of our teams. Our offices are open for those who prefer to work in-person and we also support remote work where it aligns with our operational requirements. For certain positions, being close to one of our offices or within a specific geographic area is important to facilitate collaboration, access to resources, or alignment with our service regions. In these cases, the job description will clearly indicate any working location requirements. Our goal is to ensure that all members of our team can contribute effectively, whether they are working on-site, in a hybrid model, or fully remotely. All offers of employment are contingent upon an individual’s ability to secure and maintain the legal right to work at the company and in the specified work location, if applicable.

Fraudulent Employment Offers

Samsara is aware of scams involving fake job interviews and offers. Please know we do not charge fees to applicants at any stage of the hiring process. Official communication about your application will only come from emails ending in ‘@samsara.com’ or ‘@us-greenhouse-mail.io’. For more information regarding fraudulent employment offers, please visit our blog post here.

Apply for this job

7d

Software Engineer - Workers Core Platform

CloudflareHybrid or Remote
Bachelor's degreepostgressqlDesignapijavac++typescriptkubernetesjavascript

Cloudflare is hiring a Remote Software Engineer - Workers Core Platform

About Us

At Cloudflare, we have our eyes set on an ambitious goal: to help build a better Internet. Today the company runs one of the world’s largest networks that powers approximately 25 million Internet properties, for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Locations: Austin TX 

About the Department

Emerging Technologies & Incubation (ETI) is where new and bold products are built and released within Cloudflare. Rather than being constrained by the structures which make Cloudflare a massively successful business, we are able to leverage them to deliver entirely new tools and products to our customers. Cloudflare’s edge and network make it possible to solve problems at massive scale and efficiency which would be impossible for almost any other organization.

The Workers teams makes it possible for Cloudflare customers to run JavaScript and WebAssembly on Cloudflare's edge network. We build and maintain the serverless technology that executes billions of requests per month on behalf of developers and grants them nearly limitless control over how their requests are handled and responded to.

The Workers Core Platform team delivers features that enable Cloudflare Workers customers to manage, configure and deploy their code. The team also ensures our critical core platforms scale and provide fundamental, reusable building blocks for customers.

What you will do

As a member of the Workers Core Platform team, you will collaborate with Engineers, Designers, and Product Managers to design, build and support large scale, customer facing systems that push the boundaries of what is possible at Cloudflare's edge computing platform. You will drive projects from idea to release, delivering solutions at all layers of the software stack to empower the Cloudflare customers. You can expect to interact with a variety of languages and technologies including, but not limited to Go, Kubernetes, Postgres SQL, Typescript, JavaScript, Rust. You will be expected to support the health and availability of critical services by being part of an on-call rotation.

Examples of desirable skills, knowledge and experience

  • 3+ years of professional experience building and managing software applications.
  • Understanding of computer science fundamentals including data structures, algorithms, object-oriented principles and API design.
  • Knowledge of at least one modern programming language such as Go, TypeScript, Rust, Java, C#, or JavaScript.
  • Experience in designing and architecting distributed systems.
  • Experience in designing and implementing REST APIs.
  • Experience working with cloud platforms, familiarity with cloud concepts.
  • Experience in SQL, familiarity with common relational database concepts.
  • Experience in testing, debugging, troubleshooting, optimizing and identifying possible failures.
  • Familiarity with the web and technologies such as web browsers, HTTP, JavaScript.
  • Familiarity with Kubernetes, Kafka, Clickhouse.

 

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job

7d

Systems Engineer, Workers Onboarding

CloudflareHybrid or Remote
Bachelor's degreesqlDesigngraphqlc++postgresqltypescriptkubernetesjavascriptfrontend

Cloudflare is hiring a Remote Systems Engineer, Workers Onboarding

About Us

At Cloudflare, we have our eyes set on an ambitious goal: to help build a better Internet. Today the company runs one of the world’s largest networks that powers approximately 25 million Internet properties, for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Position Location: Austin, TX | Lisbon, Portugal | London, UK

About the Department

Emerging Technologies & Incubation (ETI) is where new and bold products are built and released within Cloudflare. Rather than being constrained by the structures which make Cloudflare a massively successful business, we are able to leverage them to deliver entirely new tools and products to our customers. Cloudflare’s edge and network make it possible to solve problems at massive scale and efficiency which would be impossible for almost any other organization.

The Workers team makes it possible for Cloudflare customers to run JavaScript and WebAssembly on Cloudflare's edge network. We build and maintain the serverless technology that executes billions of requests per month on behalf of developers and grants them nearly limitless control over how their requests are handled and responded to.

The Workers Onboarding team aims to provide the best in class experience for Workers users to move fast and quickly bring ideas to life.

What you will do

As a member of the Workers team, you will collaborate with Engineers, Designers, and Product Managers to design, build and support large scale, customer facing systems that push the boundaries of what is possible at Cloudflare's edge computing platform. You will drive projects from idea to release, delivering solutions at all layers of the software stack to empower the Cloudflare customers. You can expect to interact with a variety of languages and technologies including, but not limited to Go, JavaScript, Typescript, SQL, GraphQL, Rust, and C++.

Requisite Skills

  • 4+ years professional software engineering experience
  • Experience with large-scale systems
  • Must have strong experience with Javascript, Typescript, and one of the following: Go, C++, Rust
  • Experience working in frontend frameworks such as React
  • Experience with SQL and common relational database systems such as PostgreSQL
  • Experience with Kubernetes or similar deployment tools
  • Product mindset and comfortable talking to customers and partners
  • Experience delivering projects end-to-end – gathering requirements, writing technical specifications, implementing, testing, and releasing
  • Comfortable managing multiple projects simultaneously
  • Comfortable working on an oncall shift

Bonus Points

  • Experience with metrics and observability tools such as Prometheus, Grafana
  • Experience using Workers and Pages
  • Experience scaling systems to meet increasing performance and usability demands
  • Knowledge of OAuth and building integrations with third-parties
  • Has managed interns or mentored junior engineers

 

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job

7d

Software Engineer, Web Frameworks

CloudflareHybrid or Remote
Bachelor's degreeDesignapic++typescriptangularjavascriptNode.js

Cloudflare is hiring a Remote Software Engineer, Web Frameworks

About Us

At Cloudflare, we have our eyes set on an ambitious goal: to help build a better Internet. Today the company runs one of the world’s largest networks that powers approximately 25 million Internet properties, for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Position Location: Austin, TX | Lisbon, Portugal | London, UK

About the Role

Our team’s core mission is to enable developers to do what they do best — build powerful applications.  We believe they should be able to do this without having to think or worry about infrastructure, scaling, or performance. While Cloudflare Workers, Cloudflare’s solution to serverless computing, handles the infrastructure part, there’s so much more that goes into enabling developers to do their jobs. In this role you will work on a wide range of projects that enable our platform to integrate seamlessly with the existing Web development ecosystem, including developing and improving integration with full stack web frameworks, developer tools for bundling, transpiling, and performance optimizations. You’ll also be exposed to JS API design and standardization work, and development or integration of backwards/forwards compatibility API layers for Web and Node.js APIs. If this excites you, come join our team of talented engineers that enables developers all around the world to build low-latency planet-scale applications for the Internet and the Web!  

About the Department

Our team Frameworks and ecosystem is part of Cloudflare's Emerging Technology and Incubation (ETI) team where new, bold products are built and released within Cloudflare. Rather than being constrained by the structures which make Cloudflare a successful business, ETI leverages our network to deliver entirely new tools and products to our customers. Our most successful endeavors include the Cloudflare development platform, which is composed of Cloudflare Workers, Pages, R2, D1, and many other developer products.

What you'll do

As a member of the Frameworks & JS APIs team, you will put yourself in the shoes of developers using our development platform and make them successful in building their applications and deploying them on to our platform by creating and improving integrations with popular web frameworks, libraries, and tools. Along the way you’ll influence the JavaScript ecosystem by participating in designing JavaScript APIs, defining design patterns and architectures, as well as surfacing optimizations, that allow developers to build applications that take full advantage of our globally distributed, low latency network.

To this end, you will:

  • Collaborate closely with JavaScript web frameworks teams and tooling teams across the industry to ensure smooth development and production interoperability with our platform. Examples include Angular, Astro, Next, Nuxt, Qwik, Remix, Solid, SvelteKit, as well as Vite, Rollup, and many others.
  • Surface requirements and collaborate with internal teams to build features to support ecosystem integrations.
  • Contribute to open source projects across the web ecosystem in order to add features, fix issues, and improve integrations.
  • Build and improve libraries, and tools that improve ecosystem compatibility, and the getting started experience, like C3 (create-cloudflare CLI) and next-on-pages CLI.
  • Build demo applications, starter kits, and templates that enable developers to learn about our platform and get started using frameworks and libraries they are familiar with.
  • Participate in JavaScript API design efforts evolving our platform, as well as JavaScript standards.
  • Evaluate compatibility gaps between our workerd JavaScript runtime and Node.js, implement compatibility layers and polyfills to reduce developer friction when using existing libraries with our platform.
  • Contribute to internal and public-facing technical documentation, and author blog posts.
  • If applicable to ongoing projects, support the health and availability of services by being part of an on-call rotation.
  • Collaborate with engineers across Cloudflare, and contribute at many layers of the stack.
  • Leverage your creativity and developer prowess to seek out new ways to improve the platform.

About you

We want you to love it here! This role is a good fit for you if you are:

  • Excited by the idea of helping application developers be successful.
  • Experienced with and passionate about development tools, libraries, frameworks, and workflows.
  • Experienced in web application development, but attracted to digging a layer or two below to work on libraries, frameworks, and tools that power web application development.
  • Very experienced with JavaScript and TypeScript, web standards, JavaScript module systems, module resolution, code transformation, ASTs, and more.
  • Able to get familiar with internal architecture and workings of libraries and tools quickly, in order to propose integration strategies, or architectural adjustments.
  • Energized by mind-bending debugging sessions often involving unfamiliar code bases, complex build toolchains, and exotic bugs.
  • Excited to own your work from early discussions on.
  • Naturally curious and eager to take a step to learn something new, and share your learnings with others.
  • Above all, a collaborator and effective communicator. You want to join a team that upholds a culture of support, open and honest communication, and vulnerability, and that values collaboration over heroism. We celebrate our achievements, support each other when we make mistakes, and hold each other and our work to the highest standard.

You’ll really feel right at home if you have:

  • Experience using the Cloudflare Workers development platform
  • Experience contributing to OSS software development or maintaining OSS projects
  • Public speaking or developer relations skills

 

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job

7d

Développeur(euse) logiciel Full-Stack

DimonoffQuébec, Canada, Remote
laraveldockertypescriptjavascriptPHP

Dimonoff is hiring a Remote Développeur(euse) logiciel Full-Stack

Description du poste

Tu es une personne passionnée par le développement ? Un travail local qui a un impact mondial, ça te dit? Nous avons le poste parfait pour toi ! ????

Nous recherchons un(e) développeur(euse) logiciel Full Stack. Ton expertise sera une force au sein de notre équipe !

En tant que membre de notre équipe de développeur(euse) logiciel, tu joueras un rôle clé en participant au développement, à l’accompagnement et à la réalisation de projets d’envergures, au sein d’une équipe multidisciplinaires.

Voici de quoi seront composées tes journées :  

  • Définir et proposer des solutions techniques pour les clients
  • Développer des interfaces pour des objets connectés
  • Effectuer du code de qualité et les tests qui s’en suivent
  • Participer à la conception de l’architecture du logiciel plateforme
  • Évaluer et analyser l’architecture logiciel du produit développé 
  • Participer à la création de produits innovant
  • Continuer de te développer sur plusieurs technologies  

Qualifications

Nous recherchons une personne ayant :   

  • Connaissances de ces technologies (atout considérable) Go, PHP, Laravel, Javascript , Typescript, Docker, Vue.JS, Angular.JS

  • DEC en informatique et/ou BAC en informatique / Génie logiciel   

  • Minimum de 3-5 ans en développement de logiciel.

  • L’anglais ‘’lu’’ est un requis car tu seras amené(e) à lire de la documentation technique ou autre en anglais de différentes provenances (clients, littérature, réseaux etc.) 

  • Un désir d’apprendre et de cheminer dans l’entreprise   

See more jobs at Dimonoff

Apply for this job

8d

QA Automation Engineer (Cypress)

Applaudo StudiosSão Paulo, Brazil, Remote
agileBachelor's degreeDesignuiscrumapiqagitjavaswaggertypescriptjavascript

Applaudo Studios is hiring a Remote QA Automation Engineer (Cypress)

Job Description

About you

We are looking for an experienced QA Automation Engineer with a keen eye for detail to design testing procedures for our customer’s software applications. Ready for the challenge?

You bring to Applaudo the following competencies:

  • 5+ years of experience in software testing and quality assurance.
  • 5+ years of experience working with Cypress for UI and API automation testing.
  • 5+ years of experience working with JavaScript (Typescript) for test script development.
  • 5+ years of experience working with Java for test script development.
  • 3+ years of experience with  REST-Assured for API Test Automation.
  • Familiarity with tools such as  Postman, Swagger, Visual Studio , IntelliJ, Git, Jenkins.
  • Excellent programming and debugging skills, with test automation tools and libraries such as Selenium, TestNG, Junit, among others.
  • Knowledge of test case management tools, TestRail, Zephyr Scale, Jira.
  • Familiarity with agile methodologies and DevOps practices.
  • Excellent problem-solving skills and attention to detail.
  • Performance testing knowledge is a plus.
  • Fast-paced learning and collaborative mindset.
  • Strong written and oral communication skills in English are mandatory, as you will be working directly with US-based clients.
  • Bachelor's degree in Computer Science, Engineering, or a related field.

You will be accountable for the following responsibilities:

  • Plan, analyze, design, develop, execute and maintain manual and automated test scenarios and test data, this includes determining priority for test scenarios and creating execution plans to implement these scenarios.
  • Identify opportunities for automation within software processes.
  • Identify and clearly document bugs found. Deliver regular reports on bugs found.
  • Support design and execute test automation strategy for the projects along with other developers and QA Analysts.
  • Coordinate the test plans with project managers, development managers and others
  • Initiate the analysis, design, implementation, and execution of tests, monitor test progress and results, and check the status of exit criteria (or definition of done)
  • Automate collection and delivery of test progress and test summary reports.
  • Support the selection and implementation of automation tools.
  • Introduce suitable metrics for measuring test progress and evaluating the quality of the testing.

Qualifications

  • Knowledge of automation and agile methodologies (SCRUM), ISTQB certification (CFTL is a plus).

See more jobs at Applaudo Studios

Apply for this job

8d

Senior Data Engineer

IndigoRemote with Frequent Travel
sqlDesignpythonAWSjavascriptNode.js

Indigo is hiring a Remote Senior Data Engineer

Company Description

Healthcare providers spend roughly $20B annually on premiums for medical professional liability (“MPL”) insurance, $5-6B of which is spent for physicians. Incumbent carriers utilize outdated risk selection, underwriting, and sales processes. For the first time in 10 years, The MPL market is currently in a hardening cycle. While incumbent carriers are increasing rates to make up for underwriting losses, the environment is ripe for an innovative disruptor to capture market share by deploying artificial intelligence.

Rubicon Founders, an entrepreneurial firm focused on building and growing transformational healthcare companies, has launched Indigo to address this issue. Backed by Oak HC/FT, this company will disrupt the medical professional liability market by offering more competitive products to providers. Benefitting from significant potential cost savings as a result, providers may reallocate resources to invest more directly in patient or staff care. This company intends to fulfill Rubicon Founder’s mission of creating enduring value by impacting people in a measurable way.   

Position Description

Are you an expert data engineer with a passion for making a difference in the healthcare industry? If so, we want you to join our team at Indigo, where we're using technology to transform medical professional liability insurance. Our AI driven underwriting process and modern technology streamline the insurance process and equip quality physicians and groups with the coverage they need.

As a senior data engineer you will own the various data components of our system, which includes our data model architecture, our data pipeline / ETL, and any ML data engineering needs. You will help us leverage existing data platforms and databases with best practices to ensure that the data strategy is coherent, that our data systems are highly available, secure, and scalable. You will work with cross-functional teams including business stakeholders, product managers, and data scientists to ensure our data pipeline system meets business requirements and adheres to best practices.  

 

We are a remote distributed team who gathers with intention. You will thrive here if you find energy working from home and getting together to build relationships. At Indigo, you'll have the opportunity to contribute to a meaningful mission that makes a difference in the lives of healthcare providers and their patients.

 

Responsibilities:

  • Design and build the Indigo data pipeline and ETL process.
  • Design and build the Indigo application datastore architecture and implementation 
  • Define a governance and lineage strategy.
  • Define and implement security across our data systems.
  • Participate in code reviews and ensure the code is of high quality.
  • Collaborate with cross-functional teams including product and engineering to understand business requirements and translate them into technical requirements.
  • Keep up to date with emerging trends in data engineering and contribute to improving our development processes.

Requirements:

  • Bachelor’s degree in CS or similar; masters advantageous
  • 5+ years of data engineering experience 
  • Expert SQL and Python or Javascript (Node.js)
  • Experience with AWS services such as EC2, Lambda, RDS, DynamoDB, and S3.
  • Experience with Snowflake, dbt
  • Strong understanding of data design principles
  • Experience designing and building data products from concept to productization.
  • Experience with automation in the processes of data definition, migration.
  • Excellent design and problem-solving skills.
  • Self starter, highly autonomous, thrives in a remote distributed environment



See more jobs at Indigo

Apply for this job

8d

Intermediate Full-Stack Software Developer

MedfarYerevan, Armenia, Remote
sqlDesignazurec++.nettypescriptangularjavascriptreactjs

Medfar is hiring a Remote Intermediate Full-Stack Software Developer

Job Description

As an Intermediate Full Stack Developer, you will be a member of the R&D Team and you will participate in the analysis, design, implementation and deployment of software tools and platforms that will be used by the other product development teams so that they can develop the healthcare field through new practices and technological innovations. 

You ideally have experience in developing large-scale software solutions, excellent leadership and communication skills, as well as a rigorous and analytical mindset with a data-driven problem-solving approach.

What you'll do:

  • Translate the needs and vision of the company into an adequate architecture (both software and hardware).
  • Select appropriate technologies and frameworks; ability to assess the impact of these choices on all business operations.
  • Design and develop robust, resilient, secure and scalable web application architectures, both front-end and back-end.
  • Participate in the continuous improvement of our software development processes.
  • Help support other team members in terms of coaching, supervision and code review.
  • Perform any other related tasks.

Qualifications

Contribute with your strengths:

  • College or university diploma in the field of software development or any other related field of expertise.
  • 3 to 5 years of experience in the architecture and deployment of systems in cloud computing environments.
  • Experience in test automation (unit, integration, front-end), with CI / CD pipelines, and DevOps processes.
  • In-depth knowledge of .NET application architecture and C # programming.
  • Advanced skills in JavaScript or Typescript programming.
  • Experience with a front-end framework (ReactJS, Angular, VueJS, etc.) as well as with SQL Server, SQL programming and performance analysis/optimization.
  • Knowledge of best security practices.
  • Ability to work as part of a team.
  • Ability to communicate fluently in English.
  • Experience in the health and medical IT field (asset).
  • Advanced knowledge of software architecture and infrastructure within the Microsoft Azure framework (asset).

See more jobs at Medfar

Apply for this job

8d

Business Analyst

O-IPoznań, Poland, Remote
Bachelor degreeDesigncsspythonjavascript

O-I is hiring a Remote Business Analyst

Job Description

You will be responsible for partnering with our global and regional Sales & Marketing teams to drive a business value creation and achieve top NPS score, to support the customer experience process and create effectiveness and efficiency in various Sales & marketing processes, through data, analytics and processes automation

Work in a lean setup with focus on delivery and act as subject matter expert for Nice-Satmetrix Customer Experience (NPX) application, CRM and other sales & marketing tools providing support, guidance and training to commercial users in the business.

Develop the capabilities and fostering the culture to achieve top NPS score.

Lead efforts to derive actionable insights from data through advanced analytics, machine learning, and other technologies, enabling data-driven decision-making.

Buildup automation capabilities for Order To Cash and Deploy cutting edge Intelligent selling models.

This role interacts with cross functional teams, like Sales & Marketing, IT , Sustainability departments, and external consultants/vendors to ensure alignment on standards and process, data, and technology decisions and plays a critical role in the evolution of the global commercial business processes.

About you:

You should have the ability to work seamlessly among multiple areas of the organization and interact with people from different regions and countries. You have strong analytical skills, enjoy working in a team environment (global scale), and be able to pick up new concepts quickly.

Qualifications

  • Bachelor degree required in Data Science, Computer Science.
  • 2-3 years data scientist and/or sales and/or IT experience.
  • Experience in data management, advanced analytics and Machine learning.
  • Proven experience in Power Bi, Power automate, SQL.
  • Programming skills in languages like JavaScript, HTML, CSS, Python are a plus.
  • Knowledge of design thinking principles
  • Creative mindset and ability to think innovatively
  • Effective communicator (both written and verbal), with the ability to work seamlessly among multiple levels and areas of an organization as well as in a multi-cultural environment.
  • Problem-solving skills and passionate to learn new technologies.

See more jobs at O-I

Apply for this job

8d

QA Engineer

BloomreachBratislava / Slovakia; Brno, Prague / Czech Republic; (Remote CEE)
agileremote-firstjirauiapiqac++pythonjavascript

Bloomreach is hiring a Remote QA Engineer

Bloomreach is the world’s #1 Commerce Experience Cloud, empowering brands to deliver customer journeys so personalized, they feel like magic. It offers a suite of products that drive true personalization and digital commerce growth, including:

  • Discovery, offering AI-driven search and merchandising
  • Content, offering a headless CMS
  • Engagement, offering a leading CDP and marketing automation solutions

Together, these solutions combine the power of unified customer and product data with the speed and scale of AI optimization, enabling revenue-driving digital commerce experiences that convert on any channel and every journey. Bloomreach serves over 850 global brands including Albertsons, Bosch, Puma, FC Bayern München, and Marks & Spencer. Bloomreach recently raised $175 million in a Series F funding round, bringing its total valuation to $2.2 billion. The investment was led by Goldman Sachs Asset Management with participation from Bain Capital Ventures and Sixth Street Growth. For more information, visit Bloomreach.com.

 

What challenge awaits you?

As the QA Engineer in the Engineering team, you will take care of the quality of our product. Our engineering teams are collocated around some business features and sub-domains of our complex product. Therefore we want to empower the team with a dedicated QA Engineer who will entirely focus on this area and help us adopt the principle of continuous testing.

You will be responsible for managing test scenarios and test suites, executing them, and finding ways to automate them. You will influence the QA strategy for the team by defining best practices and quality gates. 

We are building teams with a product mindset, so every member needs to care about quality. We need someone who will help us accelerate this and have QA in mind and heart. You will show our software engineers the importance and beauty of quality assurance and test automation, and they will help you deal with complex technical challenges. 

(Your salary start from 2000€ per month with stock options and other benefits included. Working in one of our Central Europe offices or from home on a full-time basis.)

 

Your job will be to:

  1. Working within the team to deliver projects
  2. Improve QA strategy in the team
  3. Maintain test scenarios and test suites
  4. Cooperate with the Central QA team

 

Working within the team to deliver projects

  • Cooperate with the team during the whole project life-cycle and be responsible for assuring the quality of the delivered solution.
  • Perform manual E2E testing (UI, API) of delivered features.
  • Automate test scenarios (UI, API) and build test suites for future regression testing.

Improve QA strategy in the team

  • Help the team to adopt the idea of continuous testing.
  • Ensure we track, classify, and manage defects found during development or production.
  • Bring new ideas and principles (like performance API testing, contract testing, …), evaluate their benefits and adapt them to QA strategy.
  • Ensure all team members understand what testing layers we have and how they can use them during development to assure quality.

Maintain test scenarios and test suites

  • Make sure we do have reasonable test suites for critical features.
  • Regular monitoring and debugging of existing automated tests (UI, API).
  • Evaluation of test results, reporting possible issues and proactively improving the stability and reliability of our tests. 

Cooperate with the Central QA team

  • Share best practices and ideas with the Central QA team (both directions)
  • Make sure the engineering team is following the overall QA strategy.
  • Be an active member of our QA community. 

 

Your success story will be:

  • In 30 days, you will participate in projects as a QA engineer and ensure the quality of delivered solutions with help from the Central QA team.
  • In 90 days, you will manage test scenarios and test cases of main features, and you will be able to automate some of them.
  • In 180 days, you will be able to come up with ideas on how to improve QA strategy in a team. 

 

You have the following experience and qualities:

  1. Professional— professional experience in Quality Assurance, including test automation
  2. Personal— independence, pro-activity and can-do attitude; and fluency in English

 

Professional experience

  • You have experience with Quality Assurance in software engineering, ideally from a cross-functional team (mix of software engineers and QA engineers).
  • You can automate tests (UI or API) and ideally have some knowledge of JavaScript, Python or Go.
  • Ideally, you should be familiar with API testing (manual and automated), API performance testing, and mocking servers. 
  • Familiar with Continuous Testing, Lean, Agile, DevOps, CI/CD principles and tools like Jira and GitLab.
  • Knowledge and experience with tools like Selenium, Cypress, PostMan, K6, and LambdaTest, MockServer are also welcomed.

 

Personal qualities

  • Pro-activity during problem-solving and learning new things and principles.
  • Can-do attitude - confident and willing to deal with problems or new tasks.
  • Independence and self-organization to navigate you through ambiguous situations.
  • Fluency in English and exceptional communication skills for leading your team.

#LI-DU1

More things you'll like about Bloomreach:

Culture:

  • A great deal of freedom and trust. At Bloomreach we don’t clock in and out, and we have neither corporate rules nor long approval processes. This freedom goes hand in hand with responsibility. We are interested in results from day one. 

  • We have defined our5 valuesand the 10 underlying key behaviors that we strongly believe in. We can only succeed if everyone lives these behaviors day to day. We've embedded them in our processes like recruitment, onboarding, feedback, personal development, performance review and internal communication. 

  • We believe in flexible working hours to accommodate your working style.

  • We work remote-first with several Bloomreach Hubs available across three continents.

  • We organize company events to experience the global spirit of the company and get excited about what's ahead.

  • We encourage and support our employees to engage in volunteering activities - every Bloomreacher can take 5 paid days off to volunteer*.
  • TheBloomreach Glassdoor pageelaborates on our stellar 4.6/5 rating. The Bloomreach Comparably page Culture score is even higher at 4.9/5

Personal Development:

  • We have a People Development Program -- participating in personal development workshops on various topics run by experts from inside the company. We are continuously developing & updating competency maps for select functions.

  • Our resident communication coachIvo Večeřais available to help navigate work-related communications & decision-making challenges.*
  • Our managers are strongly encouraged to participate in the Leader Development Program to develop in the areas we consider essential for any leader. The program includes regular comprehensive feedback, consultations with a coach and follow-up check-ins.

  • Bloomreachers utilize the $1,500 professional education budget on an annual basis to purchase education products (books, courses, certifications, etc.)*

Well-being:

  • The Employee Assistance Program -- with counselors -- is available for non-work-related challenges.*

  • Subscription to Calm - sleep and meditation app.*

  • We organize ‘DisConnect’ days where Bloomreachers globally enjoy one additional day off each quarter, allowing us to unwind together and focus on activities away from the screen with our loved ones.

  • We facilitate sports, yoga, and meditation opportunities for each other.

  • Extended parental leave up to 26 calendar weeks for Primary Caregivers.*

Compensation:

  • Restricted Stock Units or Stock Options are granted depending on a team member’s role, seniority, and location.*

  • Everyone gets to participate in the company's success through the company performance bonus.*

  • We offer an employee referral bonus of up to $3,000 paid out immediately after the new hire starts.

  • We reward & celebrate work anniversaries -- Bloomversaries!*

(*Subject to employment type. Interns are exempt from marked benefits, usually for the first 6 months.)

Excited? Join us and transform the future of commerce experiences!

If this position doesn't suit you, but you know someone who might be a great fit, share it - we will be very grateful!


Any unsolicited resumes/candidate profiles submitted through our website or to personal email accounts of employees of Bloomreach are considered property of Bloomreach and are not subject to payment of agency fees.

 #LI-Remote

See more jobs at Bloomreach

Apply for this job

9d

Join Our Talent Community – Experienced Hires

MuteSixLondon, United Kingdom, Remote
scalasqlB2BsalesforceazurepythonAWSjavascript

MuteSix is hiring a Remote Join Our Talent Community – Experienced Hires

Job Description

Why join our Talent Community?

As we’re continuously growing, we are looking for curious technology enthusiasts to match against an exciting array of opportunities. Here in the UK, we have a broad spectrum of roles spanning our four key practice areas: Analytics, MarTech & Data, Experience & Commerce along with Media. There are opportunities for everyone and with our fantastic internal mobility policy there’s always options to explore a new area! You’ll certainly never be bored!

The areas that we’re seeing the most growth in/are looking for expertise in are the following:

·       Decisioning – Architects and Data Engineers:experts with PEGA, Scala, AWS, Azure, Salesforce Marketing Cloud etc.

·       SEO:Looking for both technical and all-rounders at all levels

·       Creative –Designers (Graphic, DCO (In motion/HMTL5), Producers and Resource Managers (PM’s)

·       Analytics –One of our largest practice areas, spanning Engineering (AWS, Azure, Adobe etc), Advanced Analytics (Python, R, SQL, JavaScript) , Business Intelligence, Media Solutions and Experienced Analytics.

·       Programmatic –we’re platform agnostic so happy to speak with anyone who has some Prog experience and is looking for a new chapter.

·       Planner/Buyers (Account Managers) – these roles are sat in our B2B team whereby you’ll plan across digital/OOH and also get involved in some HUGE sponsorship/brand partnerships.

In addition to the above we're also keen to speak to exceptional client services / client partners, anyone with experience in a corporate function (HR, IT, Ops)

Qualifications

Why join us?

This is a hugely exciting time to join Merkle! We're the growth engine within the dentsu group and have no plans to slow down!  We care deeply about our people and take great pride in our values and culture; we have more than 35 nationalities represented in our office and strive to create an environment where our employees enjoy coming to work every day!

Some of our benefits include:

  • Extensive learning opportunities, through our dedicated Dentsu University.
  • Flexible public holidays, swap days off according to your values and beliefs
  • Flexible working – we empower our people to work in a way that works best for you.
  • 3 Wellness days, 2 charity days and your birthday day off on top of our 25 days annual leave.
  • Benefits tailored to you – you pick what works for you from our dedicated benefits hub.
  • Fantastic parental leave, sick leave, neonatal leave, carers leave etc.
  • And all this is just a taster! 

Interested in finding out more?

Share your CV with us on here and one of our dedicated TA Partners will be in touch for an exploratory chat. We’ll be keen to understand a little more about you, your aspirations, and goals before we dive into opportunities, we feel are best aligned to you.

We look forward to speaking with you soon.

Dream. Do. Deliver. (Only with Merkle)

Apply for this job

9d

Senior Cloud Platform Engineer

SignifydDenver, CO; New York City, NY; United States (Remote);
Bachelor degreeterraformDesignjavaelasticsearchmysqltypescriptkubernetespythonAWSjavascript

Signifyd is hiring a Remote Senior Cloud Platform Engineer

Signifyd is looking to hire a Senior Cloud Platform Engineer responsible for the design, implementation, and management of our cloud-based infrastructure. You will lead a team of highly skilled engineers maintaining and automating a vast cloud-based computing environment supporting Signifyd’s decision platform. The candidate will collaborate with development teams and fellow cloud infrastructure engineers to address critical issues. Proficiency in cloud technologies, containers, Kubernetes, networking, security, scripting, automation, and platform engineering, ensuring seamless system operations. The candidate should possess strong technical aptitude, software development skills, analytical and communication skills, and exceptional problem-solving ability. For this role, we are open to hiring an SE3 or SE4 level.

What You'll Do

  • Collaborate with cross-functional teams to design, build, and maintain highly available, scalable, and secure cloud-based services, promoting efficiency and self-service principles.
  • Develop and maintain automation scripts and tools to streamline infrastructure provisioning, configuration, and deployment, empowering engineering teams.
  • Implement and manage Kubernetes clusters for container orchestration, monitoring, and scaling.
  • Drive an evolution of services to support cloud-native managed services, including an evolution of Kubernetes.
  • Drive efforts to enhance cloud infrastructure security, including access controls, encryption, and vulnerability assessments, focusing on engineering security solutions.
  • Collaborate on CI/CD (TeamCity) pipelines to automate software deployment, including the build platform (Java, Gradle Enterprise) and QA/Testing tooling to drive DevEx up and CFR to zero, emphasizing engineering and self-service automation.
  • Define and maintain cloud engineering best practices and standards to ensure design and implementation consistency.
  • Collaborate with software engineers to optimize applications for cloud deployment, emphasizing performance and scalability.
  • Evaluate emerging cloud and DevOps technologies, providing recommendations for integration into cloud engineering practices.
  • Participate in capacity planning and resource optimization for cost-effective cloud infrastructure usage.
  • Troubleshoot complex engineering issues, provide root cause analysis and propose engineering-focused solutions.
  • Create and maintain comprehensive documentation related to the cloud infrastructure, engineering practices, and security configurations.
  • Mentor and provide technical guidance to junior team members, fostering a culture of excellence.

 

What You'll Need

  • Proficiency in cloud platforms (AWS, GCP) with a focus on engineering best practices.
  • Extensive expertise in Kubernetes (self-managed and cloud-managed flavors, architectures, operations, etc.), cloud infrastructure (AWS and GCP), and ideally databases (at least one of MySQL, Cassandra, DynamoDB, or Elasticsearch)
  • Deep knowledge of best practices for cloud environments, including security, cost optimization, operational excellence, reliability, and performance efficiency.
  • In-depth knowledge of networking principles, protocols, and security best practices for high-performance solutions.
  • Strong understanding of DevOps practices, CI/CD pipelines (TeamCity, GitHub Actions, AWS CodePipeline), and infrastructure-as-code tools (e.g., Terraform, Pulumi).
  • Excellent problem-solving skills, effective in a fast-paced, collaborative environment.
  • Excellent experience in Infrastructure-As-Code (IaC) best practices (Terraform).
  • Experience in software development in general, with skills in a high-level language (e.g., Python, JavaScript, TypeScript, Java) and familiarity with modern development practices
  • Understanding of Cloud Observability, Monitoring, and Tracing tools (Datadog, CloudWatch, Jaeger, ELK) and how best to leverage to support effective MTTR and mitigate high CFR

#LI-Remote
 

Benefits in our US offices:

  • Discretionary Time Off Policy (Unlimited!)
  • 401K Match
  • Stock Options
  • Annual Performance Bonus or Commissions
  • Paid Parental Leave (12 weeks)
  • On-Demand Therapy for all employees & their dependents
  • Dedicated learning budget through Learnerbly
  • Health Insurance
  • Dental Insurance
  • Vision Insurance
  • Flexible Spending Account (FSA)
  • Short Term and Long Term Disability Insurance
  • Life Insurance
  • Company Social Events
  • Signifyd Swag

We also want to provide an inclusive interview experience for all, including people with disabilities. We are happy to provide reasonable accommodations to candidates in need of individualized support during the hiring process.

Signifyd provides a base salary, bonus, equity and benefits to all its employees. Our posted job may span more than one career level, and offered level and salary will be determined by the applicant’s specific experience, knowledge, skills, and abilities, as well as internal equity and alignment with market data.

USA Base Salary Pay Range
$160,000$200,000 USD

See more jobs at Signifyd

Apply for this job

9d

QA Automation Engineer (SDET II)

Live PersonHyderabad, Telangana, India (Remote)
Designapiqajavajenkinspythonjavascript

Live Person is hiring a Remote QA Automation Engineer (SDET II)

LivePerson (NASDAQ: LPSN) is the global leader in enterprise conversations. Hundreds of the world’s leading brands — including HSBC, Chipotle, and Virgin Media — use our award-winning Conversational Cloud platform to connect with millions of consumers. We power nearly a billion conversational interactions every month, providing a uniquely rich data set and safety tools to unlock the power of Conversational AI for better customer experiences.

At LivePerson, we foster an inclusive workplace culture that encourages meaningful connection, collaboration, and innovation. Everyone is invited to ask questions, actively seek new ways to achieve success, nd reach their full potential. We are continually looking for ways to improve our products and make things better. This means spotting opportunities, solving ambiguities, and seeking effective solutions to the problems our customers care about.

Overview
Over the next three years, our goal is to transform the 268 billion analogue phone calls between a brand and it’s consumers to digital on the LiveEngage platform. By doing this, we enable consumers to get back time and experience a more connected relationship with the brand in which sales, service, marketing, branches, stores, and contact center's become a unified experience.

The successful candidate has an opportunity to join a highly outstanding team within a fast-paced and successful organization.

You Will

We are looking for a Quality Assurance (QA) engineer to develop and execute exploratory and automated tests to ensure product quality. QA engineer responsibilities include understanding system requirements, designing and implementing tests and in some cases debugging and defining corrective actions. You will also review system requirements and track quality assurance metrics (e.g. defect densities and open defect counts.)

  • Review requirements, specifications and technical design documents to provide timely and meaningful feedback
  • Create detailed, comprehensive and well-structured test plans and test cases
  • Create System, Resiliency and Performance verification test plans and test cases
  • Estimate, prioritize, plan and coordinate testing activities
  • Design, develop and execute automation scripts using open source tools
  • Identify, record, document thoroughly and track bugs
  • Perform thorough regression testing when bugs are resolved
  • Develop and apply testing processes for new and existing products to meet client needs
  • Liaise with internal teams (e.g. developers and product managers) to identify system requirements
  • Monitor debugging process results
  • Investigate the causes of non-conforming software and train users to implement solutions
  • Track quality assurance metrics, like defect densities and open defect counts
  • Stay up-to-date with new testing tools and test strategies

You Have

  • 5+ Years of experience
  • BS/MS degree in Computer Science, Engineering or a related subject
  • Proven work experience in software quality assurance
  • Strong knowledge of software QA methodologies, tools and processes
  • Experience testing SPA and REST based API’s in microservices based software
  • Experience in writing clear, concise and comprehensive test plans and test cases
  • Strong programming skills in one of the languages such as: Java, Python, Go, Groovy, Proven, Javascript
  • Experience is QA automation tools, frameworks and libraries
  • Hands-on experience with both white box and black box testing
  • Hands-on experience with automated testing tools and libraries
  • Experience working in an Agile/Scrum development process
  • Experience with performance, resiliency and/or security testing is a must
  • Experience testing high scalable distributed systems is a must
  • Experience working with Chaos Monkey, JMeter  is a plus
  • Knowledge of CI/CD and experience working with Jenkins or similar tools.

Benefits

  • Health: Medical, Dental, and Vision
  • Time away: Vacation and holidays
  • Development: Generous tuition reimbursement and access to internal professional development resources.
  • Equal opportunity employer

Why You’ll Love Working Here

As leaders in enterprise customer conversations, we celebrate diversity, empowering our team to forge impactful conversations globally. LivePerson is a place where uniqueness is embraced, growth is constant, and everyone is empowered to create their own success. And, we're very proud to have earned recognition from Fast Company, Newsweek, and BuiltIn for being a top innovative, beloved, and remote-friendly workplace.

Belonging At LivePerson
We are proud to be an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to age, ancestry, color, family or medical care leave, gender identity or expression, genetic information, marital status, medical condition, national origin, physical or mental disability, protected veteran status, race, religion, sex (including pregnancy), sexual orientation, or any other characteristic protected by applicable laws, regulations and ordinances. We also consider qualified applicants with criminal histories, consistent with applicable federal, state, and local law.

We are committed to the accessibility needs of applicants and employees. We provide reasonable accommodations to job applicants with physical or mental disabilities. Applicants with a disability who require reasonable accommodation for any part of the application or hiring process should inform their recruiting contact upon initial connection.

Apply for this job

9d

Senior Software Engineer - Workers Runtime

CloudflareHybrid or Remote
Bachelor's degreeapic++linuxjavascript

Cloudflare is hiring a Remote Senior Software Engineer - Workers Runtime

About Us

At Cloudflare, we have our eyes set on an ambitious goal: to help build a better Internet. Today the company runs one of the world’s largest networks that powers approximately 25 million Internet properties, for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Available Locations: Austin, TX | Lisbon, Portugal | London, UK

About the Department

Emerging Technologies & Incubation (ETI) is where new and bold products are built and released within Cloudflare. Rather than being constrained by the structures which make Cloudflare a massively successful business, we are able to leverage them to deliver entirely new tools and products to our customers. Cloudflare’s edge and network make it possible to solve problems at massive scale and efficiency which would be impossible for almost any other organization.

About the Team

The Workers Runtime team delivers features and improvements to our Runtime which actually executes customer code at the edge. We care deeply about increasing performance, improving JS API surface area and compiled language support through WebAssembly, and optimizing to meet the next 10x increase in scale. The Runtime is a hostile environment - System resources such as memory, cpu, I/O, etc need to be managed extremely carefully and security must be foundational in everything we do.

What you'll do

We are looking for a Systems Engineer to join our team. You will work with a team of passionate, talented engineers that are building innovative products that bring security and speed to millions of internet users each day. You will play an active part in shaping product features based on what’s technically possible. You will make sure our company hits our ambitious goals from an engineering standpoint.

You bring a passion for meeting business needs while building technically innovative solutions, and excel at shifting between the two—understanding how big-picture goals inform technical details, and vice-versa. You thrive in a fast-paced iterative engineering environment.

Examples of desirable skills, knowledge and experience

  • At least 3 years of recent professional experience with C++.
  • Solid understanding of computer science fundamentals including data structures, algorithms, and object-oriented or functional design.
  • An operational mindset - we don't just write code, we also own it in production
  • Deep understanding of the web and technologies such as web browsers, HTTP, JavaScript and WebAssembly
  • Experience working in low-latency real time environments such as game streaming, game engine architecture, high frequency trading, payment systems.
  • Experience debugging, optimizing and identifying failure modes in a large-scale Linux-based distributed system.

Bonus Points

  • Experience building high performance distributed systems in Rust.
  • Experience working with cloud platforms, especially server-less platforms.
  • Experience with the internals of JS engines such as V8, SpiderMonkey, or JavaScriptCore
  • Experience with standalone WebAssembly runtimes such as Wasmtime, Wasmer, Lucet, etc
  • Deep Linux/UNIX systems, kernel, or networking knowledge
  • Contributions to large open source projects

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job

9d

D1 Software Engineering Manager

CloudflareHybrid or Remote
Bachelor's degreepostgressqlc++javascript

Cloudflare is hiring a Remote D1 Software Engineering Manager

About Us

At Cloudflare, we have our eyes set on an ambitious goal: to help build a better Internet. Today the company runs one of the world’s largest networks that powers approximately 25 million Internet properties, for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Job Location: Austin, TX

About the Department

Emerging Technologies & Incubation (ETI) is where new and bold products are built and released within Cloudflare. Rather than being constrained by the structures which make Cloudflare a massively successful business, we are able to leverage them to deliver entirely new tools and products to our customers. Cloudflare’s edge and network make it possible to solve problems at massive scale and efficiency which would be impossible for almost any other organization.

What you'll do

We announced Cloudflare Workers in 2017  — since then it’s played a key role in Cloudflare’s strategy for entering the developer platform market. Until the launch of Workers, as Cloudflare was ramping up its capabilities in the performance and security spaces, it became clear that developers needed more ways to control the edge than rules engines could support. Workers has allowed Cloudflare to add programmability to the edge such that developers could have access to writing logic on the edge in their preferred way — through code. Over the past few years, Workers has grown from a simple functions-as-a-service option into a fully blown full-stack platform. With any application, however, in addition to serverless compute, you need to be able to manage state. In 2022, Cloudflare released D1 — built on Durable Objects, D1 is Cloudflare’s first serverless database. 
In this role, you’ll be helping define and build the future of D1, making sure we’re focused on the highest priority projects to enable developers to build full stack applications. 

Examples of desirable skills, knowledge and experience

  • Experience with any of the following programming languages: JavaScript, C++, Web Assembly. Rust or Go
  • Experience with SQL databases (e.g. SQLite, Postgres)
  • Experience using best practices for operating software in a software-as-a-service environment
  • Experience planning and overseeing execution to meet commitments and deliver with predictability
  • Experience implementing tools, process, internal instrumentation, methodologies and resolving blockages
  • Comfortable hiring and leading a workstream aligned team with both fullstack and distributed systems skillsets

Bonus Points

  • Experience building software for developers either open source or business-to-business
  • Experience building distributed systems or databases

 

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job