Node.js Remote Jobs

192 Results

+30d

Backend Software Engineer

PintoNew York, NY, Remote
nosqlDesignmongodbgraphqlAWSNode.js

Pinto is hiring a Remote Backend Software Engineer

Job Description

  • You’ll use your skills to help solve real-world problems, while learning about the food, consumer products, and personalized nutrition ecosystem
  • You’ll work across the Pinto Services stack using tools and languages like JavaScript/TypeScript, Node.js, MongoDB, GraphQL, AWS
  • You’ll work with our Research, Nutrition, & Data Analyst teams to gain a deep knowledge of underlying use cases in food data and nutrition
  • You’ll envision and create new features for our core data platform, which processes large, complex data sets from a variety of sources 
  • You’ll envision and create tools that contribute to and enhance our end-to-end data pipeline
  • You’ll model, design and implement complex data integrations with our industry partners

 

Qualifications

  • Experience with: Node.JS, JavaScript/TypeScript, working with NoSQL databases, building data processes from start to finish
  • 3+ years of professional software development experience
  • Bachelor's degree in computer science (or similar) or equivalent practical experience
  • A track record of shipping high-quality software from start to finish
  • A solid foundation in computer science fundamentals with sound knowledge of data structures, algorithms, and system design
  • Comfortable in a fast-paced startup environment
  • Self-aware and have a desire to learn and improve

Bonus points for

  • Example of code projects you’ve worked on (e.g. GitHub, BitBucket)
  • Experience with: GraphQL, Amazon Web Services (AWS), MongoDB, building performant distributed systems
  • Experience working with large, complex data sets from a variety of sources
  • Strong communication skills

See more jobs at Pinto

Apply for this job

+30d

Lead Software Engineer – Shopping Experience

agilefigmaDesigngraphqliosUXrubypostgresqltypescriptcssjavascriptNode.js

Stitch Fix is hiring a Remote Lead Software Engineer – Shopping Experience

 

MultiThreaded Engineering, UX and Design at Stitch Fix

At Stitch Fix, our goal is to help our customers look great and feel great about themselves by revolutionizing how people shop. In a time-starved world where shopping often feels overwhelming, our business connects customers to clothes they love. Whether it’s helping someone dress for success at a new job or taking the stress out of packing for a family vacation, we fix clients’ closets – and they love us for it!

We’ve built unique, innovative software for merchandising, warehouse and inventory management, remote styling, and logistics. We leverage vast amounts of client data to make decisions throughout the company. All of this results in a simple, powerful offering to our clients and a very successful business. We believe we are only scratching the surface of our opportunity, and we’re looking for incredible people to contribute!

Lead Software Engineer – Shopping Experience

LEAD SOFTWARE ENGINEER

About The Role

Stitch Fix’s Shopping Experience Engineering team is looking for a curious, empathetic, and self-aware full stack Lead Engineer. If you’re looking for client obsessed, high profile and impactful work, this team is for you. We are responsible for most of the client-facing experiences once our client is onboarded until checkout. We are always striving to make the shopping experience better for our clients. We work closely with our product, design, UX, data science, data engineering and iOS partners using data to grow our product. 

You will be working with a team of full stack engineers with varied backgrounds who thrive in a collaborative environment. You will be expected to lead projects working with your engineering teammates to define technical approaches and milestones while also working with your cross functional partners to help shape business requirements and inform capabilities around designs. You will have the opportunity to identify and define technical investments: improving our platforms, increasing developer velocity and broadening and hardening our observability. We operate in an agile-inspired manner across multiple time zones within the United States. We build modern software with modern techniques like TDD, continuous delivery, DevOps, and service-oriented architecture. We focus on high-value solutions for clearly identified problems but are designed in a sustainable way and deliver long term value.

We are excited about you because... 

  • You have roughly 5+ years of professional programming experience.
  • 1+ years of technical leadership experience
  • You are bright, kind, and motivated by challenge.
  • You thrive in collaborative teams and treasure helping your team members grow and learn.
  • You practice curiosity, kindness, and making change.
  • You believe that strong teams are built on trust with clear and honest communication.
  • You clearly set and share your priorities with your team and partners.
  • You understand and focus on what is right for the client.
  • You build high-quality solutions and are pragmatic about weighing project scope and value.
  • You are flexible, dedicated to your craft, and curious.
  • You might be product focused and enjoy brainstorming around features with our partners.
  • You might have prior experience working with design systems.
  • You mighthave prior experience with accessibility best practices.
  • You mighthave prior experience with Next.js.

 

About the Technology

Technologies we rely on to pursue solutions to business problems include things like:

  • Ruby, Rails
  • GraphQL and PostgreSQL
  • React
  • Node.js and Next.js
  • JavaScript / TypeScript
  • CSS / SCSS
  • Figma
  • Datadog
  • Percy

 

While experience with any of these is a bonus, our primary focus is hiring an engineer that enjoys solving problems for and with people.

About Stitch Fix

At Stitch Fix, we’re about personal styling for everybody and we believe in both a service and a workplace where you can be your best, most authentic self. We’re the first fashion retailer to combine technology and data science with the human instinct of a Stylist to deliver a deeply personalized shopping experience. This novel juxtaposition attracts a highly diverse group of talented people who are both thinkers and doers. All of this results in a simple, powerful offering to our customers and a successful, growing business serving millions of men, women, and kids. We believe we are only scratching the surface on our opportunity, and we’re looking for incredible people like you to help us carry on that trend.

You'll Love Working At Stitch Fix Because We

  • Are a technologically and data-driven business. 
  • Are at the forefront of tech and fashion, redefining shopping for the next generation. 
  • Are passionate about our clients and live/breathe the client experience. 
  • Get to be creative every day. 
  • We cultivate a community of diverse perspectives— all voices are heard and valued.
  • Believe in autonomy & taking initiative. 
  • Full support for remote work. 
  • Offer transparent, equitable, and competitive compensation based on your level to help eliminate bias in salaries, as well as equity and comprehensive health benefits. 
  • Are serious about our commitment to life-work balance, and have generous parental leave policies.
Compensation and Benefits

Our anticipated compensation reflects the cost of labor across several US geographic markets, and the range below indicates the low end of the lowest-compensated market to the high end of the highest-compensated market. This position is eligible for new hire and ongoing grants of restricted stock units depending on employee and company performance. In addition, the position is eligible for medical, dental, vision, and other benefits. Applicants should apply via our internal or external careers site.
Salary Range
$156,000$201,000 USD

This link leads to the machine readable files that are made available in response to the federal Transparency in Coverage Rule and includes negotiated service rates and out-of-network allowed amounts between health plans and healthcare providers. The machine-readable files are formatted to allow researchers, regulators, and application developers to more easily access and analyze data.

Please review Stitch Fix's US Applicant Privacy Policy and Notice at Collection here: https://stitchfix.com/careers/workforce-applicant-privacy-policy

Recruiting Fraud Alert: 

To all candidates: your personal information and online safety are top of mind for us.  At Stitch Fix, recruiters only direct candidates to apply through our official career pages at https://www.stitchfix.com/careers/jobs or https://web.fountain.com/c/stitch-fix.

Recruiters will never request payments, ask for financial account information or sensitive information like social security numbers. If you are unsure if a message is from Stitch Fix, please email RecruitingOperations@stitchfix.com

You can read more about Recruiting Scam Awareness on our FAQ page here: https://support.stitchfix.com/hc/en-us/articles/1500007169402-Recruiting-Scam-Awareness 

 

See more jobs at Stitch Fix

Apply for this job

+30d

Lead Software Engineer – Discover

Stitch FixRemote, USA
agilefigmaDesigngraphqluiiosUXrubytypescriptcssjavascriptbackendfrontendNode.js

Stitch Fix is hiring a Remote Lead Software Engineer – Discover

LEAD SOFTWARE ENGINEER - FRONT-END FOCUS 

About Stitch Fix

At Stitch Fix, we’re about personal styling for everybody and we believe in both a service and a workplace where you can be your best, most authentic self. We’re the first fashion retailer to combine technology and data science with the human instinct of a Stylist to deliver a deeply personalized shopping experience. This novel juxtaposition attracts a highly diverse group of talented people who are both thinkers and doers. All of this results in a simple, powerful offering to our customers and a successful, growing business serving millions of men, women, and kids. We believe we are only scratching the surface on our opportunity, and we’re looking for incredible people like you to help us carry on that trend.

About The Role

Stitch Fix’s Discover Engineering team is looking for a curious, empathetic, and self-aware Front End Lead Engineer with comfortability in back end systems. We are responsible for the client facing homepage, and as such, control the first impression of clients logging onto our site. We continually aim to retain clients and increase revenue via personalized, relevant logged-in experiences that drive high-value actions that boost engagement with our products and services. We work closely with our product, design, UX, data science, and data engineering partners to use data to grow our product. If you’re looking for cross functional, client driven, and interesting work, this team is for you. 

You will be working within a team of engineers with varied backgrounds, ranging from frontend, backend and iOS, who thrive in a collaborative environment. We are looking for an engineer to lead and mentor with opinionated front end patterns to help maintain standards and evolve our UI services.

This is a remote position available within the United States. We operate in an agile-inspired manner across multiple time zones. We build modern software with modern techniques like TDD, continuous delivery, DevOps, and service-oriented architecture. We focus on high-value solutions for clearly identified problems but are designed in a sustainable way and deliver long term value.

You’re excited about this opportunity because you will…

  • Help design, develop, and continue to grow solutions that directly impact the retention and engagement of existing clients.
  • Be an owner of highly visible, high-impact, cross-team projects.
  • Collaborate with stakeholders while leading the technical discovery, decision-making, and execution of complex and/or critical projects within the team, across web and iOS platforms. 
  • Operate as an engaged member of the engineering team - leading meetings, attending ceremonies, providing input on technical design documents & project plans, pairing with other engineers to work toward a solution, etc. 
  • Provide technical leadership, mentorship, pairing opportunities, timely feedback, and code reviews to encourage the growth of others.
  • Share the responsibility of directing the team’s investment in impactful directions.
  • Contribute to a culture of technical collaboration and scalable, resilient systems.
  • Work within a distributed team of software engineers and cross-functional partners who are passionate about their craft.
  • Have high responsibility for deliverables and will be helping to guide what you work on.

We are excited about you because... 

  • You get excited about solving problems using frontend technologies, including JavaScript, React, and CSS.
  • You have roughly 6+ years of professional programming experience.
  • You have experience independently leading cross-team projects & initiatives. 
  • You have strong written communication skills and are able to develop strong working relationships with coworkers and business partners. 
  • You have 1+ years of experience in technical leadership - including driving technical decisions and guiding broader project goals.
  • You are bright, kind, and motivated by challenge.
  • You have excellent analytical skills as well as communication skills both verbal and written. 
  • You treasure helping your team members grow and learn.
  • You take initiative and operate with accountability. 
  • You believe that strong teams are built on trust.
  • You understand and focus on what is right for the customer.
  • You build high-quality solutions and are pragmatic about weighing project scope and value.
  • You are flexible, dedicated to your craft, and curious.
  • You mighthave experience with Next.js and/or Typescript.
  • You mighthave experience with GraphQL schema design. 

You might have experience with Ruby on Rails.

About the Technology

  • React & Next.js
  • JavaScript / TypeScript
  • CSS / SCSS
  • GraphQL
  • Node.js
  • Ruby on Rails
  • Figma
  • Datadog
  • Storybook
  • Percy
  • Playwright

Even if you already have experience with these tools, you'll have the chance to get even better with them. And if you don't already use all of these tools, we will help you learn and become effective with them.

You'll Love Working At Stitch Fix Because We…

  • Are a technologically and data-driven business. 
  • Are at the forefront of tech and fashion, redefining shopping for the next generation. 
  • Are passionate about our clients and live/breathe the client experience. 
  • Get to be creative every day. 
  • We cultivate a community of diverse perspectives— all voices are heard and valued.
  • Believe in autonomy & taking initiative. 
  • Full support for remote work. 
  • Offer transparent, equitable, and competitive compensation based on your level to help eliminate bias in salaries, as well as equity and comprehensive health benefits. 
  • Are serious about our commitment to life-work balance, and have generous parental leave policies.
Compensation and Benefits

Our anticipated compensation reflects the cost of labor across several US geographic markets, and the range below indicates the low end of the lowest-compensated market to the high end of the highest-compensated market. This position is eligible for new hire and ongoing grants of restricted stock units depending on employee and company performance. In addition, the position is eligible for medical, dental, vision, and other benefits. Applicants should apply via our internal or external careers site.
Salary Range
$186,000$201,000 USD

This link leads to the machine readable files that are made available in response to the federal Transparency in Coverage Rule and includes negotiated service rates and out-of-network allowed amounts between health plans and healthcare providers. The machine-readable files are formatted to allow researchers, regulators, and application developers to more easily access and analyze data.

Please review Stitch Fix's US Applicant Privacy Policy and Notice at Collection here: https://stitchfix.com/careers/workforce-applicant-privacy-policy

Recruiting Fraud Alert: 

To all candidates: your personal information and online safety are top of mind for us.  At Stitch Fix, recruiters only direct candidates to apply through our official career pages at https://www.stitchfix.com/careers/jobs or https://web.fountain.com/c/stitch-fix.

Recruiters will never request payments, ask for financial account information or sensitive information like social security numbers. If you are unsure if a message is from Stitch Fix, please email RecruitingOperations@stitchfix.com

You can read more about Recruiting Scam Awareness on our FAQ page here: https://support.stitchfix.com/hc/en-us/articles/1500007169402-Recruiting-Scam-Awareness 

 

See more jobs at Stitch Fix

Apply for this job

+30d

Mid to Senior Full Stack Engineer | $120K - $200K+ | Work For An Exciting SaaS or Hi-Tech Company

PhillyTechPhiladelphia, PA, Remote
sqlDesignmobilemongodbazuregraphqluiapirubyjavac++.netpostgresqlmysqlangularpythonAWSjavascriptbackendNode.js

PhillyTech is hiring a Remote Mid to Senior Full Stack Engineer | $120K - $200K+ | Work For An Exciting SaaS or Hi-Tech Company

Job Description

Are you a mid level to senior level full stack engineer with 3-15+ years experience, who is driven by challenges and excited by the prospect of developing cutting-edge software solutions for a high growth SaaS company?

Do you have a passion for building scalable, reliable, and high-performing web and mobile applications that make a difference?

Do you want to see the features and functionality that you're building are being used and enjoyed by clients and realize that your work is contributing to generating revenue growth for a SaaS company?

  • Our Software as a Service (SaaS) client is looking for mid level to senior full stack engineers to join their team.
  • As a mid-level to senior full stack engineer, you will be responsible for developing and maintaining the company's core products and services.
  • You will be involved in all aspects of the software development life cycle, from design and implementation to testing and deployment.
  • You will work closely with other engineers, product managers, and designers to develop new features, improve existing ones, and ensure the highest level of quality for customers.
  • You will need to have a strong foundation in both front-end and back-end development, as well as experience with cloud infrastructure and database design.

You will also need to be comfortable working with multiple programming languages and frameworks, such as the ones listed below.

YOU DON'T NEED TO KNOW ALL OF THESE LANGUAGES, BUT THESE ARE THE PRIMARY ONES OUR SAAS AND HI-TECH CLIENTS WORK WITH DAY TO DAY.

FRONT END FRAMEWORKS

React: React.js is one of the most popular front-end frameworks used in SaaS companies. It's a component-based library that allows developers to build reusable UI components. React has a large and active community, which makes it easy to find resources, plugins, and tools to enhance development.

Angular: Angular.js is a full-featured front-end framework developed by Google. It's designed to build complex, scalable, and high-performance web applications. Angular provides a wide range of tools and features, including two-way data binding, dependency injection, and reactive programming.

Vue.js: Vue.js is a progressive and lightweight front-end framework that offers a simple and elegant API for building user interfaces. Vue.js is known for its simplicity, flexibility, and ease of integration with other libraries and frameworks.

Ember.js: Ember.js is a mature and opinionated front-end framework that provides a complete solution for building ambitious web applications. Ember.js is known for its conventions, which makes it easy to write code that's consistent and easy to maintain.

Backbone.js: Backbone.js is a lightweight front-end framework that provides a minimal set of features for building scalable and maintainable web applications. Backbone.js is known for its simplicity, flexibility, and compatibility with other libraries and frameworks.

BACK END AND DATA DRIVEN FRAMEWORKS

Node.js: Node.js is a server-side JavaScript runtime that allows developers to build back-ends using the same language as the front-end. It's known for its high performance, scalability, and flexibility, making it a popular choice for SaaS companies.

C# / .NET is a modern, multi-paradigm programming language developed by Microsoft for building a wide range of applications, including desktop, web, and mobile applications. It's widely used in the development of enterprise-level applications, including those used by SaaS companies.

Ruby on Rails: Ruby on Rails is a popular framework for building back-ends of web applications, and it's widely used in SaaS companies. It provides a rich set of features that makes it easy to build complex web applications quickly and efficiently.

Spring: Spring is a popular Java-based framework for building enterprise-grade web applications. It's known for its scalability, modularity, and integration capabilities, which makes it a popular choice for large-scale projects.

Elixir is a functional, dynamic programming language that runs on the Erlang virtual machine. It was designed to provide a scalable and fault-tolerant platform for building distributed, concurrent applications. Elixir is known for its elegant syntax, pattern matching, and metaprogramming capabilities, making it a popular choice for building web applications, APIs, and real-time systems.

GraphQL is a query language for APIs that was developed by Facebook. It provides a more efficient, powerful, and flexible alternative to traditional REST APIs. With GraphQL, clients can specify exactly what data they need, and the server can respond with exactly that data, minimizing the amount of data transferred over the network. This reduces network latency and improves application performance. GraphQL is language-agnostic, meaning that it can be used with any programming language, including JavaScript, Python, Ruby, and many others.

Python is a high-level, interpreted programming language that is widely used for software development, data analysis, machine learning, and web development. Python is commonly used in SaaS companies for various tasks, such as web development, backend development, automation, and data analysis.

CLOUD AND DATABASE ENVIRONMENTS

Cloud Environments - Amazon Web Services (AWS) and Azure Web Services

Database Environments - MySQL, PostgreSQL, Microsoft SQL Server, MongoDB, Cassandra, Amazon DynamoDB, Amazon RDS, Microsoft Azure SQL Database, Google Cloud SQL, Neo4j and Amazon Neptune

Qualifications

You MUST live in the United States and speak very good or excellent English.

You MUST be a citizen, have your Green Card or long-term visa.

You MUST A-Caliber Engineer or Developer with 3-15+ years experience

What are the qualifications of an A-Caliber Engineer or Developer?

  • You have great communication skills, are a team player and love to learn.
  • You're a highly skilled and experienced professional who is passionate about software engineering and development.
  • You have a proven track record of developing and delivering high-quality software solutions and possess a deep understanding of the latest software development methodologies, tools, and technologies.
  • You would have strong problem-solving skills and can work independently or as part of a team to design, develop, test, and deploy software applications that meet the business requirements and user needs.
  • You are highly proficient in multiple programming languages and frameworks.

Apply for this job

+30d

NodeJs Developer- Winter Internship 2024

SolvativeIndia Remote
nosqlmobilecssNode.js

Solvative is hiring a Remote NodeJs Developer- Winter Internship 2024

NodeJS-2024 Winter Software Developer Internship

Development Center, Ahmedabad, Gujarat, India.

Headquarters: Dallas, TX

Solvative is looking for student applicants for its 2024 Winter Software Developer Internship Program.

The ideal candidate is either a 2023/2024 graduate with a Bachelor of Engineering in Computer Science or related engineering fields. Candidates with B.C.A/M.C.A. or other related programs may also apply. The ideal candidate will have strong fundamentals of Computer Science algorithms and modern software development skills in mobile, web, and other areas.

As an intern, Solvative will mentor and provide on the job training on live client projects. Your primary responsibility would be to assist our senior developers and get yourself familiarized with the professional execution cycle of a software project. Solvative creates and maintains a variety of software products.

Note: This is a remote paid Internship. We will allow you to fulfill your academic compliances.

Requirement:

  • Strong knowledge of Node.js and its ecosystem.
  • Familiarity with NoSQL databases, particularly MongoDB.
  • Proficient understanding of code versioning tools, such as Git.
  • Understanding of front-end technologies, including HTML, CSS, and JavaScript.
  • Strong problem-solving skills and attention to detail.
  • About you:
  • Excellent academic record.
  • Unwavering attitude to learn.
  • Updated knowledge of new technologies.

    Contact Details
    WhatsApp Number: +918153938010, +918668759737

Why Solvative?

  • Top of the line Apple laptops for increased mobility and better productivity.
  • Medical insurance for all permanent employees.
  • The opportunity of working with an organization that believes in investing in employees’ growth.
  • An absolutely informal work environment that enables you to have fun while being productive.
  • Lots and lots of fun activities, we take over one of the nearby restaurants every last Friday of the month, tickets to all Marvel movies for the entire team, company picnics, and more!

See more jobs at Solvative

Apply for this job

+30d

Full Stack- Winter Internship 2024

SolvativeAhmedabad, IN Remote
oraclemobilemysqlcssangularjavascriptNode.js

Solvative is hiring a Remote Full Stack- Winter Internship 2024

Full Stack-2024 Winter Software Developer Internship

Development Center, Ahmedabad, Gujarat, India.

Headquarters: Dallas, TX

Solvative is looking for student applicants for its 2024 Winter Software Developer Internship Program.

The ideal candidate is either 2023/2024 graduate with a Bachelor of Engineering in Computer Science or related engineering fields. Candidates with B.C.A/M.C.A. or other related programs may also apply. The ideal candidate will have strong fundamentals of Computer Science algorithms and modern software development skills in mobile, web, and other areas.

As an intern, Solvative will mentor and provide on the job training on live client projects. Your primary responsibility would be to assist our senior developers and get yourself familiarized with the professional execution cycle of a software project. Solvative creates and maintains a variety of software products.

Note: This is a remote paid Internship. We will allow you to fulfill your academic compliances.

Requirement-

  • Proficiency with fundamental front-end languages such as HTML, CSS, and JavaScript.
  • Familiarity with JavaScript libraries/frameworks such as Angular, React, and Vue.
  • Proficiency with Node.js
  • Familiarity with database technology such as MySQL, Oracle, and MongoDB.
  • Proficient understanding of code versioning tools, such as Git.
  • Consider yourself a generalist engineer and are willing to wear many hats, sometimes at the same time.

About you:

  • Excellent academic record.
  • Unwavering attitude to learn.
  • Updated knowledge of new technologies.
  • Strong understanding of client/server and OOPS basics.

It would be a big plus if,

  • You have excellent written and oral communication skills.
  • Have hands-on experience on MEAN or MERN stack.
  • If any of your academic projects include IoT.

    Contact Details
    WhatsApp Number: +918153938010

Why Solvative?

  • Top of the line Apple laptops for increased mobility and better productivity.
  • Medical insurance for all permanent employees.
  • The opportunity of working with an organization that believes in investing in employees’ growth.
  • An absolutely informal work environment that enables you to have fun while being productive.
  • Lots and lots of fun activities, we take over one of the nearby restaurants every last Friday of the month, tickets to all Marvel movies for the entire team, company picnics, and more!


See more jobs at Solvative

Apply for this job

+30d

Full Stack Developer

PlaysonRemote job, Remote
10 years of experiencepostgresB2BDesignazuredockermysqltypescriptcssAWSjavascriptreduxbackendfrontendNode.js

Playson is hiring a Remote Full Stack Developer

????Playson is a B2B game provider with 10 years of experience on the market. Since 2012, we have ambitiously developed worldwide recognition in the industry. Nowadays, our primary focus is on European markets, and we operate in 20+ jurisdictions. As of 2022, we are continuously working on enhancing our portfolio, encompassing best practices in order to meet the highest standards of technology, design, support, and interoperability.

We are looking for a passionateFullstack Developer to join our Forge Squad in Platform Tribe and scale professionally with us. The perfect candidate is ready to take responsibility and be the owner of his stream of work.


To succeed in the role, you have to:

  • Experience with JavaScript (ES6), TypeScript, Node.js
  • Excellent knowledge of computer science, database theory, and code-testing practices
  • Understanding of network interactions and protocols, conventions
  • Backend experience with Node.js (Rx.js, Async, Inversify)
  • Frontend experience with React.JS, Redux
  • Experience in CSS, SCSS (BEM, SMACSS)
  • Experience with the development of production-ready solutions
  • Experience with relational databases (MySQL or Postgres)
  • Understanding Event Sourcing and CQRS approaches
  • Experience with non-relational databases (DynamoDB, Redis, Cassandra, ClickHouse)
  • Understanding of orchestration and virtualization (Docker)

Would be a plus:

  • Experience in leadership positions (Team Lead, Tech Lead)
  • Experience with Cloud solutions (e.g. AWS, Google Cloud, Azure)
  • Knowledge of message broker systems (e.g. Apache Kafka)
  • Experience with JavaScript frameworks
  • Understanding of application security and industry standards and best practices
  • Preferable personal skills:
  • Ability to relate positively to and engage with a wide range of people
  • Strong self-motivation, reliable and flexible team player. High attention to details
  • Always seeking to improve processes and suggest alternatively better solutions

What will you be doing?

  • Become part of a full-stack team of the product, which is positioned as an independent part of the platform
  • Develop brand new features with a distributed team and be proactive in terms of introducing new ideas
  • Develop a system from scratch
  • Back-end development of new functionality
  • Code and Architectural review
  • Proactive position in solution development, processes improvements
  • Delivering the product roadmap and planning for the future
  • Handle complex problems that might arise during solution development and provide field support with creative and rapid solutions
  • Ensure that the highest coding standards are met and write highly testable, automatable and performant code over the whole SDLC

What do you get in return:

  • Competitive salary fixed in USD with yearly performance reviews
  • Transparent bonus system on a quarterly basis
  • Private Entrepreneur formalization
  • Full taxation coverage from the company’s side
  • Flexibility in your schedule
  • Remote Work
  • Full Medical Insurance for you and your +1
  • Special Life Event financial support
  • Unlimited paid vacation leave and Ukrainian bank holidays
  • Unlimited paid sick leave in case of necessity
  • Development courses/training reimbursement
  • Online English classes that do make a difference!
  • Employee Referral bonus program

Recruitment process looks like this:

1. HR video call

2. Technical interview

3. Final Interview with Tribe Leader and CTO

Enough has been said — now let’s talk about how you can contribute to the success of Platform Tribe and Playson. Apply now!

Our mission:

Deliver entertainment and satisfaction to the lives of the busy world.

See more jobs at Playson

Apply for this job

+30d

Sr. SE I, Front End (Remote Eligible)

SmartsheetREMOTE, USA
uiUXrubyjavac++typescriptcssjavascriptNode.js

Smartsheet is hiring a Remote Sr. SE I, Front End (Remote Eligible)

We’re as excited about AI as anyone, and our investment in the space speaks to how fundamentally it can change our product and technology in general. As we spoke about at our ENGAGE customer conference this year — in the keynote, no less — we are exploring ways to make teams more efficient and effective by leveraging AI at scale, and building it into the heart of our product, not just tacking it on around the sides. This position is a huge opportunity to leverage your experience building world class front-end experiences to be at the forefront of Smartsheet’s AI strategy, which will be integral to the company’s growth for years to come.

In 2005, Smartsheet was founded on the idea that teams and millions of people worldwide deserve a better way to deliver their very best work. Today, we deliver a leading cloud-based platform for work execution, empowering organizations to plan, capture, track, automate, and report on work at scale, resulting in more efficient processes and better business outcomes.

You will report to our Manager of Engineering located in our Bellevue, WA office, or you may work remotely from anywhere in the US where Smartsheet is a registered employer.

You Will:

  • Write clean and efficient code based on product specifications and participate in the entire development life cycle, from concept to release
  • Create and promote modern web UI development
  • Develop modular, maintainable components for the next generation of applications at Smartsheet (React, JavaScript, TypeScript, Node.js, HTML, and CSS)
  • Be a technical leader on our team, implementing features in TypeScript and integrating with cloud native back-end services
  • Develop and maintain CI/CD pipeline implementations for tests, linting, deployment, etc.
  • Take part in code reviews and architectural discussions as you work with other software engineers, UX designers and product managers
  • Mentor junior engineers on code quality and other industry best practices
  • Develop services that can consume, process and act on millions of user actions within Smartsheet and scale to 100x as our as our customers continues to grow
  • Enhance existing application code with new features and strike a balance when making technical decisions (build vs refactor vs simplify)

 

You Have:

  • 5+ years software development experience
  • 5+ years experience in at least one modern object oriented programming language (Java, C#, Ruby, etc.)
  • 2+ years experience in SaaS application development
  • Experience with modern web technologies, front-end frameworks and integrating with back-end services
  • Experience building Single Page Applications at scale
  • Successful in an environment with frequent production releases
  • Experience writing complex asynchronous code that communicates with multiple services
  • A degree in Computer Science, Engineering, or a related field or equivalent practical experience
  • Legally eligible to work in the U.S. on an ongoing basis
  • While an interest in emerging AI technologies is key, direct experience building and/or maintaining these technologies in production is not strictly necessary

Perks & Benefits:

  • HSA, 100% employer-paid premiums, or Buy-up medical/vision and dental coverage options for full-time employees
  • Equity - Restricted Stock Units (RSUs) with all offers
  • Lucrative Employee Stock Purchase Program (15% discount)
  • 401k Match to help you save for your future (50% of your contribution up to the first 6% of your eligible pay)
  • Monthly stipend to support your work and productivity
  • Flexible Time Away Program, plus Incidental Sick Leave
  • Up to 24 weeks of Parental Leave
  • Personal paid Volunteer Day to support our community
  • Opportunities for professional growth and development including access to LinkedIn Learning online courses
  • Company Funded Perks, including a counseling membership, primary care membership, local retail discounts, and your own personal Smartsheet account
  • Teleworking options from any registered location in the U.S. (role specific)

Smartsheet provides a competitive range of compensation for roles that may be hired in different geographic areas we are licensed to operate our business from. Actual compensation is determined by several factors including, but not limited to, level of professional, educational experience, skills, and specific candidate location. In addition, this role will be eligible for a market competitive bonus and RSU stock grant upon accepted offer. California & New York: $145,800 to $213,300 | All other US States: $135,000 to $197,500

Equal Opportunity Employer:

Smartsheet is an Equal Opportunity Employer committed to fostering an inclusive environment with the best employees. We provide employment opportunities without regard to any legally protected status in accordance with applicable laws in the US, UK, Australia, Costa Rica, and Germany. If there are preparations we can make to help ensure you have a comfortable and positive interview experience, please let us know.

At Smartsheet, we strive to build an inclusive environment that encourages, supports, and celebrates the diverse voices of our team members who also represent the diverse needs of our customers. We're looking for people who are driven, authentic, supportive, effective, and honest. You're encouraged to apply even if your experience doesn't precisely match our job description—if your career path has been nontraditional, that will set you apart. At Smartsheet, we welcome diverse perspectives and people who aren't afraid to be innovative—join us!

#BI-Remote

#LI-Remote

See more jobs at Smartsheet

Apply for this job

+30d

Senior Software Engineer I, Full Stack (Remote Eligible)

SmartsheetREMOTE, USA
agilekotlinjiraazureuiscrumjavatypescriptcsskubernetesAWSjavascriptreduxfrontendNode.js

Smartsheet is hiring a Remote Senior Software Engineer I, Full Stack (Remote Eligible)

The Attachment Architects are responsible for all attachment related use-cases within the Smartsheet ecosystem. We collaborate with other teams to enable users of Smartsheet to attach files from several locations, providing services to download and replicate the attachments to a user’s destinations of choice. We’re a full-stack team owning from Attachment Frontend UI to Attachment Backend. You will be working with 7-8 other engineers on the re-architecture, implementation, deployment and maintenance of the frontend UI, services, and infrastructure owned by the team.

In 2005, Smartsheet was founded on the idea that teams and millions of people worldwide deserve a better way to deliver their very best work. Today, we deliver a leading cloud-based platform for work execution, empowering organizations to plan, capture, track, automate, and report on work at scale, resulting in more efficient processes and better business outcomes.

You will report to our Manager, Engineering located in our Bellevue office, or you may work remotely from anywhere in the US where Smartsheet is a registered employer.

You Will:

  • Build scalable back-end services for the next generation of applications at Smartsheet (Kotlin, Java)
  • Build responsive UI elements for the next generation of applications at Smartsheet (React, JavaScript, TypeScript, Node.js, HTML, and CSS)
  • Solve challenging distributed systems problems and work with modern cloud infrastructure (AWS, Kubernetes)
  • Participate in code reviews and architectural discussions with other software engineers and product managers
  • Take a leading role in designing key areas of scalable, performant systems
  • Mentor junior engineers on code quality and other industry best practices
  • Forge a strong partnership with product management and other key areas of the business

You Have:

  • 5+ years software development experience building highly scalable, highly available applications
  • 5+ years of programming experience with full stack technologies such Java, Kotlin or TypeScript
  • 3+ years of experience with microservice and event driven architectures
  • 2+ years of experience with cloud technologies (AWS, Azure, etc.)
  • 2+ years of experience with modern client JS libraries, like React, Redux
  • Experience developing, documenting, and supporting REST APIs
  • Experience with software development patterns such as SOLID, clean code, TDD 
  • Experience with software development practices and tools such as Agile, Scrum, Gitlab, JIRA
  • A degree in Computer Science, Engineering, or a related field or equivalent practical experience
  • Legally eligible to work in the U.S. on an ongoing basis

Perks & Benefits:

  • HSA, 100% employer-paid premiums, or buy-up medical/vision and dental coverage options for full-time employees
  • Equity - Restricted Stock Units (RSUs) with all offers
  • Lucrative Employee Stock Purchase Program (15% discount)
  • 401k Match to help you save for your future (50% of your contribution up to the first 6% of your eligible pay)
  • Monthly stipend to support your work and productivity
  • Flexible Time Away Program, plus Incidental Sick Leave
  • Up to 24 weeks of Parental Leave
  • Personal paid Volunteer Day to support our community
  • Opportunities for professional growth and development including access to LinkedIn Learning online courses
  • Company Funded Perks, including a counseling membership, local retail discounts, and your own personal Smartsheet account
  • Teleworking options from any registered location in the U.S. (role specific) 
  • US employees are automatically covered under Smartsheet-sponsored life insurance, short-term, and long-term disability plans
  • US employees receive 12 paid holidays per year

Smartsheet provides a competitive range of compensation for roles that may be hired in different geographic areas we are licensed to operate our business from. Actual compensation is determined by several factors including, but not limited to, level of professional, educational experience, skills, and specific candidate location. In addition, this role will be eligible for a market competitive bonus and RSU stock grant upon accepted offer. California & New York: $145,800 to $213,300 | All other US States: $135,000 to $197,500.

Equal Opportunity Employer:

Smartsheet is an Equal Opportunity Employer committed to fostering an inclusive environment with the best employees. We provide employment opportunities without regard to any legally protected status in accordance with applicable laws in the US, UK, Australia, Costa Rica, and Germany. If there are preparations we can make to help ensure you have a comfortable and positive interview experience, please let us know.

At Smartsheet, we strive to build an inclusive environment that encourages, supports, and celebrates the diverse voices of our team members who also represent the diverse needs of our customers. We're looking for people who are driven, authentic, supportive, effective, and honest. You're encouraged to apply even if your experience doesn't precisely match our job description—if your career path has been nontraditional, that will set you apart. At Smartsheet, we welcome diverse perspectives and people who aren't afraid to be innovative—join us!

 

#BI-Remote

#LI-Remote

See more jobs at Smartsheet

Apply for this job

+30d

Senior Software Engineer, Ads Team

IXL LearningRemote
sqlmobilec++dockerAWSjavascriptNode.js

IXL Learning is hiring a Remote Senior Software Engineer, Ads Team

IXL Learning, a leading EdTech company with products used by 15 million students worldwide, is seeking a Senior Software Engineer who has a passion for technology and education to join our new team leading programmatic digital advertising initiatives.

IXL Learning is home to 5 ads-supported properties operating under a Freemium business model, monetizing the traffic from millions of users with digital advertising:

  • SpanishDictionary.com is a leading website and mobile app for English speakers who are learning Spanish with 20 million monthly active users.
  • inglés.com is an emerging website and mobile app for Spanish speakers who are learning English with 5 million monthly active users.
  • ABCya.com is a leading learning resource featuring fun educational games for kids from pre-K to 6th grade with 15 million monthly active users.
  • Multiplication.com is an interactive learning website designed to help kids master the multiplication tables with 1 million monthly active users.
  • Homeschoolmath.net is a one-stop shop of math resources for homeschooling parents and teachers.

We are now developing our in-house adtech to consolidate and scale our advertising operations into a unified stack to service all of our ads-supported properties. We’re looking for a Senior Software Engineer to lead this exciting technical transition. #LI-FA1

This is a full-time remote position for candidates in the United States, strong preference for those in the Eastern time zone.#LI-REMOTE

WHAT YOU'LL BE DOING

  • Building a unified header-bidding ads solution using Prebid.js and Google Ad Manager (GAM) that can be used across all of IXL’s ad-supported properties
  • Optimizing billions of ad impressions to maximize revenue while maintaining a high-quality user experience
  • Executing A/B tests to improve ad revenue performance
  • Enhancing our analytics pipeline to ingest our ads events and facilitate data analysis across brands
  • Determining opportunities for growth by analyzing technical and ad performance data using Looker
  • Tracking down and addressing ad quality problems to ensure a great user experience
  • Full-stack web development using technologies like Node.js, React, SQL, AWS, and Docker

WHAT WE'RE LOOKING FOR

  • Bachelor's or advanced degree in Computer Science or a related discipline
  • Strong understanding of JavaScript
  • Knowledge of Node, React, AWS, and SQL, or the ability to learn them quickly
  • Experience with techniques for optimizing web page speed
  • Strong communication, analytical-reasoning, and problem-solving skills
  • Bonus: familiarity with the programmatic ad technologies

TEAM PROJECTS AND CULTURE

  • We developed and manage a diversified in-house header bidding advertising stack, optimized across billions of impressions.
  • We created a data analytics platform to process events from our ad system in real time, at scale, using AWS Redshift and Looker
  • We executed hundreds of A/B tests to identify optimal strategies within our ad stack
  • We optimized our sites’ performance for Core Web Vitals
  • We deployed a high-availability, automated, and scalable server infrastructure on AWS with an uptime of more than 99.999% last year.
  • We’ve brought together a talented team that is down-to-earth, friendly, and driven to build products that people use and love
  • Our technology stack is state-of-the-art, and we pride ourselves on an engineering culture committed to data-informed decisions, focus on value, rapid iteration, broad test coverage, extensive automation, peer-reviewed code, and fast deployments
  • Software drives our business, and we understand the value of having time for engineers to focus on technical priorities
  • This role will join a small team, which means every engineer on the team has a huge impact across millions of users and very low barriers to getting things done

ABOUT IXL LEARNING

IXL Learning is the country's largest EdTech company. We reach millions of learners through our diverse range of products. For example:

  • 1 in 4 students in the United States uses IXL.com
  • Rosetta Stone provides an immersive learning experience for 25 languages
  • Wyzant is the nation's largest community of tutors, covering 300+ subjects
  • Teachers Pay Teachers (TPT) is a comprehensive marketplace for millions of educator-created resources

Our mission is to create innovative products that will make a real, positive difference for learners and educators and we're looking for passionate, mission-minded people to join us in achieving this goal. We have a unique culture at IXL that fosters collaboration and the open exchange of ideas. We value our team and treat one another with kindness and respect. We approach our work with passion, tenacity, and authenticity. We find it immensely satisfying to develop products that impact the lives of millions and we are eager to have you join our team.

At IXL, we value diversity in age, race, ethnicity, gender, sexual orientation, physical and mental ability, political and religious beliefs, and life experience, and we are proud to promote a work environment where everyone, from any background, can do their best work. IXL Learning is an Equal Opportunity Employer.

Apply for this job

+30d

Senior Fullstack Engineer

UserTestingBarcelona - Remote
DesignbackendfrontendNode.js

UserTesting is hiring a Remote Senior Fullstack Engineer

We’re UserTesting, a leader in experience research and insights; we believe the path to human understanding and great experiences start with a shared understanding—seeing and hearing how another person engages with the world around them and taking in their perspective. Working at UserTesting, you will be empowered to help organizations  discover the human side of business–transforming how they work, collaborate, innovate, and bring new products and experiences to market. This is what inspires us, and it’s how we enable companies to connect with their audiences naturally and organically through an experience that is uniquely, and intentionally human.

A trusted company by top brands for 15+ years, UserTesting, recently merged with UserZoom, has over 3,400 customers in 50 countries, including 75 of the Fortune 100 companies. Joining our team means being part of a passionate group focused on transforming how companies learn from and understand their customers. Come join us and help us build the engine for human understanding.

The Opportunity

As part of the Engineering Team, you will have a great opportunity to contribute to building on our SaaS platform. Working alongside our global team you will be responsible for creating something truly amazing - the Human Insights industry is an exciting place to be right now. As UserTesting grows, so does our focus on your career and personal development. And more importantly, the team here at UserTesting is both supportive and welcoming of new team members, with plenty of social events (if you like to get involved).

Your duties and responsibilities:

  • Daily analyzing and designing reliable & scalable Engineering solutions.
  • Collaborating with the Team to bring solid software to production.
  • Being a critical referent for the architecture under work, able to defend & discuss proposals with managers and teammates.
  • Providing technical context and finding key points to boost the best decisions.
  • Bringing fresh views on Frontend, Backend and Software strategies.
  • Communicating and documenting solutions, so they can optimally go through building phases.
  • Design scalable & maintainable solutions to absorb the significant usage growth we are facing.
  • Being an active player while building, able to take and/or clarify the most difficult aspects.
  • Enforcing best practices, advocating for clean code and helping others succeed through Engineering review processes.

 

The Team

The Engineering team is an integral part of our organization, with members spanning many global locations. We are committed to build effective solutions, deliver for impact, always learn, and iteratively shape the Product to transform the business, while growing a state-of-the-art SaaS platform in a scalable and reliable way.

 

What we are looking for

  • You have strong technical skills and solid conceptual foundations.
  • Experience with Node.js and/or Typescript.
  • You love Distributed Software, Cloud solutions, Microservices & Serverless Architectures.
  • You are committed to building highly reliable & scalable systems.
  • You are eager to learn, screen those learnings and apply the best suited for a bounded context.
  • You have experience in discussing, spiking & benchmarking Engineering solutions.
  • You speak fluent English.
  • Familiarity with Reactive & Domain Driven Architectures.
  • Demonstrates UserTesting’s values through work product and within day to day team interactions.

What we offer

- Employee Assistance Program (EAP)
- Health Insurance
- Flexible retribution
- Employee Referral Program
- Professional Development Stipend
- Remote work stipend
- Wellness reimbursement 
- Volunteer days
 
 

 

To learn more about our team, culture, and customers, check out ourcareers page,company blog, andpress/awards. Aside from a great work environment and the opportunity to make an impact, we’re also growing the team quickly–join us!

At UserTesting, we are committed to providing more inclusive and accessible experiences for our candidates. We pride ourselves on building empathy; diverse perspectives, which we believe are the key values to creating exceptional experiences for everyone. Our commitment to providing accessible experiences is driven by this belief and our core values. If you require any accommodations or have any specific requests about how we could tailor our interview process to better suit your needs please contact us on:talentexperience@usertesting.com.If you need to speak to someone please ask!

******

UserTesting is an Equal Opportunity Employer and a participant in the U.S. Federal E-Verify program.  Women, minorities, individuals with disabilities and protected veterans are encouraged to apply.  We welcome people of different backgrounds, experiences, abilities and perspectives.  

UserTesting will consider qualified applicants with criminal histories in a manner consistent with the San Francisco Fair Chance Ordinance, as applicable.  

We welcome candidates with physical, mental, and/or neurological disabilities. If you require assistance applying for an open position, or need accommodation during the recruiting process due to a disability, please submit a request to People Operations by emailingaskPeopleOps@usertesting.com.

See more jobs at UserTesting

Apply for this job

+30d

Senior Systems & Infrastructure Engineering Architect

iRhythmRemote US
Bachelor's degreeterraformsqlDesignjavac++dockermysqlkuberneteslinuxpythonAWSNode.js

iRhythm is hiring a Remote Senior Systems & Infrastructure Engineering Architect

Boldly innovating to create trusted solutions that detect, predict, and prevent disease.

Discover your power to innovate while making a difference in patients' lives. iRhythm is advancing cardiac care…Join Us Now! 

At iRhythm, we are dedicated, self-motivated, and driven to do the right thing for our patients, clinicians, and coworkers. Our leadership is focused and committed to iRhythm’s employees and the mission of the company. We are better together, embrace change and help one another.  We are Thinking Bigger and Moving Faster.


 

About this role:

iRhythm is currently looking for a hands-on Senior Systems and Infrastructure Engineering Architect who will be responsible for scaling our IT platforms and support regional/international growth. They will also be responsible for building and provisioning the underlying infrastructure for our Production Systems and application stacks in AWS and other Cloud Platforms. You will drive standards, tooling and services that are used by internal and external teams. This role will also support establishing SLIs and SLOs adhering to iRhythm standards, refining performance targets, enabling Observability dashboards leveraging golden signals targeting business and technical metrics, and enforcing best practices. Automate by design and help drive the quality of the releases, system performance, and code quality, targeting customers worldwide.

Specific Job Responsibilities:

  • Participate in the Architecture assessment and design for infrastructure domains that provide core capabilities for the enterprise.
  • Lead Architecture design of integrated systems across site or regional projects and programs.
  • Participate in the design and implementation of enterprise systems and platform roll-out.
  • Participate in technology evaluation and recommendations.
  • Participate in the development and maintenance of current and planned state architecture blueprints.
  • Provides input for iRhythm’s Digital Technology and App Rationalization efforts.
  • Applies an enterprise-wide view to Infrastructure solutions to support the adoption of standards and practices and promote reusable patterns.
  • Participates in the analysis of technology industry and market trends to determine their potential impact on the Enterprise Architecture.
  • Write, build, and deploy services globally and at scale and how best to write tools to automate the entire development lifecycle.
  • Be involved with building and scaling within and across multiple regions for services that utilize Java applications, Docker, MySQL, Kubernetes, and AWS Services
  • Work on projects from the design phase so you will have the context to help with everything else on the journey to production and beyond.
  • Lead technical discussions and debugging sessions alongside development engineers during major incidents
  • Opportunity to design and lay out the foundation for an observability platform

 

About You:

  • Degree in a technical discipline or equivalent work experience.
  • Certification in TOGAF or a similar framework
  • 10+ years of experience as a technical systems and Infrastructure Engineer
  • In-depth Experience with AWS Cloud Infrastructure
  • Strong Linux system administration skills
  • Strong knowledge of networking concepts and protocols (DNS, TCP/IP, and firewalls)
  • Proficiency with Python, Go Node.js, Java or other scripting languages
  • Experience working with testing and performance automation frameworks
  • Experience with SQL databases
  • Experience with configuration management tools such as Terraform, Puppet, or Ansible.
  • Experience with container management technologies such as Docker and Kubernetes
  • Familiarity with Incident, Change and Operations Management
  • Self-sufficient, self-managed, self-motivated; must be effective working both independently and as part of a team

 What’s in it for you:

This is a regular full-time position with competitive compensation package, excellent benefits including medical, dental, and vision insurances (all of which start on your first day), health savings account employer contributions (when enrolled in high deductible medical plan), cafeteria plan pre-taxed benefits (FSA, dependent care FSA, commute reimbursement accounts), travel reimbursement for medical care, noncontributory basic life insurance & short/ long term disability. 
Additionally, we offer:

  • Emotional health support for you and your loved ones
  • Legal / financial / identity theft/ pet and child referral assistance
  • Paid parental leave, paid holidays, travel assistance for personal trips and PTO!
  • Wellness/ cultural committee/charity events

iRhythm also provides additional benefits including 401(k) (with company match), an Employee Stock Purchase Plan, pet insurance discount, unlimited amount of Linked In Learning classes, and so much more!

FLSA Status:Exempt

#LI-MC1

#LI-Remote


Actual compensation may vary depending on job-related factors including knowledge, skills, experience, and work location.


 

Estimated Pay Range
$157,800$231,600 USD

As a part of our core values, we ensure a diverse and inclusive workforce. We welcome and celebrate people of all backgrounds, experiences, skills, and perspectives. iRhythm Technologies, Inc. is an Equal Opportunity Employer. We will consider for employment all qualified applicants with arrest and conviction records in accordance with all applicable laws.

iRhythm provides reasonable accommodations for qualified individuals with disabilities in job application procedures, including those who may have any difficulty using our online system. If you need such an accommodation, you may contact us at taops@irhythmtech.com

About iRhythm Technologies
iRhythm is a leading digital healthcare company that creates trusted solutions that detect, predict, and prevent disease. Combining wearable biosensors and cloud-based data analytics with powerful proprietary algorithms, iRhythm distills data from millions of heartbeats into clinically actionable information. Through a relentless focus on patient care, iRhythm’s vision is to deliver better data, better insights, and better health for all.

Make iRhythm your path forward. Zio, the heart monitor that changed the game.

See more jobs at iRhythm

Apply for this job

+30d

Database Administrator II

ClassySan Diego, Remote
nosqlsalesforceDynamicsDesignmongodbgraphqlc++mysqllinuxpythonAWSjavascriptNode.js

Classy is hiring a Remote Database Administrator II

Classy, an affiliate of GoFundMe, is a Public Benefit Corporation and giving platform that enables nonprofits to connect supporters with the causes they care about. Classy's platform provides powerful and intuitive fundraising tools to convert and retain donors. Since 2011, Classy has helped nonprofits mobilize and empower the world for good by helping them raise over $6 billion. Classy also hosts the Collaborative conference and the Classy Awards to spotlight the innovative work nonprofits are implementing around the globe. For more information, visitwww.classy.org.

About the role:

Classy's Product Technology team is hiring a Database Administrator II to help design, build, and maintain our data services and infrastructure that drive vast volumes of financial transactions measured in millions. The ideal candidate will combine solid engineering expertise with product aptitude, driven by exciting technical challenges that come with scale, and thrive in a fast-paced, iterative, and collaborative environment. We want to talk to you if you are unfazed by the idea of optimizing and extending existing systems to make them more robust, maintainable, and scalable. 

 

What you’ll accomplish:

  • Have a critical role in maintaining robust, fault-tolerant, data integration service layers.
  • Assist Software Engineers in implementing and delivering new features leading to higher adoption of fundraising tools on the platform.
  • Build reporting and monitoring tools to ensure the stability and security of the system.
  • Develop on our highly scalable data platforms that include Aurora (MySQL), Atlas (MongoDB), Redshift and Redis.
  • Investigate and troubleshoot data processing bottlenecks to determine courses of action that predicate microservice design
  • Help develop best practices data management processes with an eye on distributed database architectures and resiliency.
  • Participate in an engineering culture of “always be learning” where the sharing and learning from failures is celebrated and the giving and receiving of constructive candid feedback is highly encouraged.
  • Maintaining existing databases with upgrades, scheduled jobs, backup/restores and security.

 

What you bring (Required):

  • Bachelor’s Degree in Computer Science or a related field, or equivalent work experience.
  • 2+ years maintaining highly scalable projects involving cloud-based infrastructures.
  • Excellent understanding of distributed data models with experience debugging distributed databases with high data loads.
  • Strong experience writing performant SQL/MQL queries for relational and non-relational databases with the ability to know what the impact of complex queries entail.
  • Proficient with programming and scripting (for example, Python, Linux Shell, Javascript ES6, Node.js, AWS (Lambda, SNS, EC2, ECS)), with the ability to read and understand existing source code in order to analyze performance and recommend improvements.
  • Experience with APM tools such as NewRelic or DataDog, and how to use those tools to troubleshoot performance issues.
  • Experience with Scrum/Agile development methodologies.
  • Proficiency in schema design in relational and NoSQL databases (MySQL, MongoDB).
  • A deep sense of quality, and sharp engineering skills with strong computer science fundamentals.
  • Experience with multi-regional cloud computing database infrastructure

What would be awesome to have (Preferred):

  • Knowledge of CRM data architecture, such as Salesforce (SFDC) or Microsoft (Dynamics 365) 
  • Experience with cached data store or search technology for fast runtime access (OpenSearch, GraphQL, Splunk, Solr, Algolia)
  • Comfortable with working on loosely coupled microservices.
  • Experience with code versioning tools (GIT/Bitbucket).
  • Experience supporting Big Data solutions

Why you’ll love it here: 

  • Market competitive pay
  • Rich healthcare benefits, including employer paid premiums for medical/dental/vision (100% for employee only plans and 85% for employee + dependent plans) and employer HSA contributions. 
  • 401(k) retirement plan with company matching
  • Hybrid workplace with fully remote flexibility for many roles
  • Monetary support for new hire setup, hybrid work & wellbeing, family planning, and commuting expenses
  • A variety of mental and wellness programs to support employees   
  • Generous paid parental leave and family planning stipend
  • Supportive time off policies including vacation, sick/mental health days, volunteer days, company holidays, and a floating holiday
  • Learning & development and recognition programs
  • Gives Back Program where employees can nominate a fundraiser every month for a donation from the company
  • Inclusion, diversity, equity, and belonging are vital to our priorities and we continue to evolve our strategy to ensure DEI is embedded in all processes and programs at GoFundMe. Our Diversity, Equity, and Inclusion team is always finding new ways for our company to uphold and represent the experiences of all of the people in our organization.
  • Employee resource groups
  • Your work has a real purpose and will help change lives on a global scale.
  • You’ll be a part of a fun, supportive team that works hard and celebrates accomplishments together. 
  • We live by our core values: impatient to be great, find a way, earn trust every day, fueled by purpose
  • We are a certified Great Place to Work, are growing fast and have incredible opportunities ahead!
  • Our commitment to Sustainability.Classy exists to create a sustainable world for all. 

 

Dedication to Diversity 

Classy is working toward building a more diverse and inclusive environment that is representative of individuals of all backgrounds, experiences, and lifestyles, allowing all employees to feel comfortable being their true, authentic selves in a space that enables productivity and meaningful work.

 

The total annual salary for this full-time position is $86,500 - $116,500 + equity + benefits.  As this is a remote position, the salary range was determined by role, level, and possible location across the US. Individual pay is determined by work location and additional factors including job-related skills, experience, and relevant education or training. 

Your recruiter can share more about the specific salary range based on your location during the hiring process. 

 

If you require a reasonable accommodation to complete a job application or a job interview or to otherwise participate in the hiring process, please contact us at accommodationrequests@gofundme.com

 

See more jobs at Classy

Apply for this job

+30d

Senior Software Engineer (Frontend)

ClassyRemote, US
agileDesignmongodbgraphqlscrumUXc++dockerelasticsearchmysqltypescriptlinuxAWSjavascriptfrontendNode.jsPHP

Classy is hiring a Remote Senior Software Engineer (Frontend)

Classy, an affiliate of GoFundMe, is a Public Benefit Corporation and giving platform that enables nonprofits to connect supporters with the causes they care about. Classy's platform provides powerful and intuitive fundraising tools to convert and retain donors. Since 2011, Classy has helped nonprofits mobilize and empower the world for good by helping them raise over $6 billion. Classy also hosts the Collaborative conference and the Classy Awards to spotlight the innovative work nonprofits are implementing around the globe. For more information, visitwww.classy.org.

About the role:

Classy's Product Technology team is hiring a Senior Front-End Software Engineer to build and extend our visualization tools, component library, and new experiences for the next phase of our business. The ideal candidate is highly skilled in front end web development using React and TypeScript, as well as building and maintaining a component library. We want to talk to you if you can see beyond the {brackets} and love transforming designs and mockups into highly-scalable, fault-tolerant, and seamless user experiences. 

What you’ll do:

  • Analyze, design, and develop software that delivers clean, maintainable code within a large, complex, and established code base.
  • Contribute to the Classy component library to be consumed throughout the organization for new and existing user experiences.
  • Learn and grow your skills by working collaboratively with experienced and engaged developers to design new features and re-architect existing ones.
  • Within an Agile environment, work as part of a Scrum team and develop web-based software solutions.
  • Mentor engineers to become proficient developers using best software development practices and processes.

What you bring (Required):

  • Bachelor’s Degree in Computer Science or a related field, or equivalent work experience.
  • 4+ years of professional software development experience with relevant web development technologies
  • Passion for UX and design, specifically building and maintaining a component library
  • Excellent understanding of distributed software architecture with experience debugging distributed systems with high data loads.
  • High-level proficiency with Javascript ES6, TypeScript & React.
  • Ability to understand product requirements and translate them into technical subtasks.
  • Experience with Scrum/Agile development methodologies.
  • Deep experience with code versioning tools (GIT/Bitbucket).
  • A deep sense of quality, and sharp engineering skills with strong computer science fundamentals.
  • Experience working with remote and offshore teams

What would be awesome to have (Preferred):

  • Experience building PCI compliant systems
  • Experience with simultaneously managing multiple web application frameworks and/or migrating from one framework to another. 
  • Experience working with MySQL, MongoDB, Node.js, PHP, Linux, & Next.js
  • Experience working with Microservice architecture and Micro Frontends
  • Familiarity with GraphQL, Elasticsearch, Docker, AWS (EC2, ECS, Lambda, SNS).
  • Familiarity with Storybook 

Why you’ll love it here: 

  • Market competitive pay
  • Rich healthcare benefits, including employer paid premiums for medical/dental/vision (100% for employee only plans and 85% for employee + dependent plans) and employer HSA contributions. 
  • 401(k) retirement plan with company matching
  • Hybrid workplace with fully remote flexibility for many roles
  • Monetary support for new hire setup, hybrid work & wellbeing, family planning, and commuting expenses
  • A variety of mental and wellness programs to support employees   
  • Generous paid parental leave and family planning stipend
  • Supportive time off policies including vacation, sick/mental health days, volunteer days, company holidays, and a floating holiday
  • Learning & development and recognition programs
  • Gives Back Program where employees can nominate a fundraiser every month for a donation from the company
  • Inclusion, diversity, equity, and belonging are vital to our priorities and we continue to evolve our strategy to ensure DEI is embedded in all processes and programs at GoFundMe. Our Diversity, Equity, and Inclusion team is always finding new ways for our company to uphold and represent the experiences of all of the people in our organization.
  • Employee resource groups
  • Your work has a real purpose and will help change lives on a global scale.
  • You’ll be a part of a fun, supportive team that works hard and celebrates accomplishments together. 
  • We live by our core values: impatient to be great, find a way, earn trust every day, fueled by purpose
  • We are a certified Great Place to Work, are growing fast and have incredible opportunities ahead!
  • Our commitment to Sustainability.Classy exists to create a sustainable world for all. 

Dedication to Diversity 

Classy is working toward building a more diverse and inclusive environment that is representative of individuals of all backgrounds, experiences, and lifestyles, allowing all employees to feel comfortable being their true, authentic selves in a space that enables productivity and meaningful work.

The total annual salary for this full-time position is $130,000- $175,000 + equity + benefits.  As this is a remote position, the salary range was determined by role, level, and possible location across the US. Individual pay is determined by work location and additional factors including job-related skills, experience, and relevant education or training. 

Your recruiter can share more about the specific salary range based on your location during the hiring process. 

If you require a reasonable accommodation to complete a job application or a job interview or to otherwise participate in the hiring process, please contact us at accommodationrequests@gofundme.com



See more jobs at Classy

Apply for this job

+30d

Full Stack Developer - React / Node.js

Hello InnovationDetroit, MI
DesignmongodbgittypescriptcssNode.js

Hello Innovation is hiring a Remote Full Stack Developer - React / Node.js

Full Stack Developer - React / Node.js - Hello Innovation - Career Page

See more jobs at Hello Innovation

Apply for this job

+30d

Application Developer

ExsilioRemote
agilesqlDesignjqueryscrumc++typescriptcssangularNode.js

Exsilio is hiring a Remote Application Developer

Application Developer 2 - Exsilio Solutions - Career Page

See more jobs at Exsilio

Apply for this job

+30d

Application Developer 1

ExsilioRemote
agilesqlDesignjquerygraphqlscrumc++typescriptcssNode.js

Exsilio is hiring a Remote Application Developer 1

Application Developer 1 - Exsilio Solutions - Career Page

See more jobs at Exsilio

Apply for this job

+30d

Node JS Developer

BuzzBoardRemote
mongodbapijavaangularfrontendNode.js

BuzzBoard is hiring a Remote Node JS Developer

Node JS Developer - BuzzBoard - Career Page

See more jobs at BuzzBoard

Apply for this job

+30d

Full Stack Software Engineer

3 years of experiencenosqlDesignmongodbhtml5angularNode.js

Bitdefender is hiring a Remote Full Stack Software Engineer

Full Stack Software Engineer - Bitdefender - Career Page

See more jobs at Bitdefender

Apply for this job

+30d

Head of Marketing

sqlB2BDesignmongodbdockertypescriptpythonAWSNode.js

Recurrency is hiring a Remote Head of Marketing

Head of Marketing at Recurrency (S20)
Automated ERP for distributors.
Remote / Remote (US)
Full-time
About Recurrency

Recurrency is a sales, pricing, and purchasing automation platform for distributors. Despite distribution being a multi-trillion dollar industry, the legacy enterprise resource planning (ERP) systems that exist to help distributors manage their purchasing, inventory, sales, order processing, and accounting are decades behind. For the most part, ERP systems are painfully slow, difficult-to-use, and soul-crushingly manual.

Recurrency’s goal is to reverse ERP stagnation by building a streamlined and intelligent ERP: blazingly fast and complete with powerful automation tools like dynamic pricing and demand forecasting. Using Recurrency can boost a distributor’s revenue and profit margins, while reducing waste and saving time. Most importantly, Recurrency is fully-integrated with the customer’s legacy system, so deploying Recurrency in production can be done in as little as one day.

Founded in Los Angeles and supporting a fully-remote team across the United States, Recurrency is a fast-growing and venture-backed team of talented technologists going all-in on building the next great platform company.

About the role

The Company

Recurrency is a sales, pricing, and purchasing automation platform for distributors. Despite distribution being a multi-trillion dollar industry, the legacy enterprise resource planning (ERP) systems that exist to help distributors manage their purchasing, inventory, sales, order processing, and accounting are decades behind. For the most part, ERP systems are painfully slow, difficult-to-use, and soul-crushingly manual.

Recurrency’s goal is to reverse ERP stagnation by building a streamlined and intelligent ERP: blazingly fast and complete with powerful automation tools like dynamic pricing and demand forecasting. Using Recurrency can boost a distributor’s revenue and profit margins, while reducing waste and saving time. Most importantly, Recurrency is fully-integrated with the customer’s legacy system, so deploying Recurrency in production can be done in as little as one day.

Founded in Los Angeles and supporting a fully-remote team across the United States, Recurrency is a fast-growing and venture-backed team of talented technologists going all-in on building the next great platform company. 

The Role

At Recurrency, you will reimagine how we communicate with our customers and prospects—to be more human, friendly—and create the messaging, positioning, go-to-market strategies, and customer focus to make us a trusted authority and partner. Our marketing is responsible for acquiring new customers and conveying our deep understanding of the problems our customers face. We’re a highly cross-functional team and partner most closely with the Product, Sales, and Customer Success teams to help our prospects and customers grasp how we can help them reach their full potential.

We are looking for a transformational marketer to bring our team from zero-to-one; a smart, ambitious self-starter and leader who can balance strategic thinking, creative ideation, and customer empathy, with team-building and coaching. The ideal candidate for this role is a marketer who can wear many hats, with proven ability to learn quickly and adapt. We’re looking for somebody who can not only be a rockstar but who can bring the whole band together, driving cross-functional execution across the entire go-to-market team.

What You’ll Do

  • Build and own Recurrency’s product-driven marketing operating model.
  • Develop our product positioning and messaging, informed by user research.
  • Champion our library of sales and marketing assets
  • Provide content marketing and demand gen leadership to define and execute pipeline generation programs
  • Steward our marketing website and collateral
  • Manage a small team of content creators and designers
  • Own the planning and execution on brand development in our industry
  • Work cross-functionally with product leadership to align marketing to product truth

About You

  • 5+ years product marketing experience, preferably in B2B SaaS
  • Prior experience managing a team of direct reports
  • Experience working at pre-IPO or growth-stage technology startup
  • A strong understanding of a B2B buyer’s journey (or transferable experience and a hunger to learn it), and are familiar with examples of inventive consumer/B2C marketing strategies.
  • A solid eye for design and knack for good storytelling with the relevant creative and writing skills to create great content
  • Technical literacy and an aptitude for data comprehension, comfortable reading, analyzing, and researching technical topics on your own
  • Ability to deal with ambiguity and create clarity for people and teams
  • Experience creating marketing strategy, dashboards and plans to meet core business objectives

First 30 days: 

  • You will gain a deep understanding and appreciation of our mission, team, and culture through interactions and our onboarding process.
  • You will begin to outline areas of opportunity within our current GTM process, and be introduced to current customers to help build your understanding of our industry

Days 30-60: 

  • You will begin to leverage your existing marketing team and identify the highest areas of opportunity for impact
  • You will develop and begin to implement a comprehensive GTM flow, identifying key milestones within the prospect journey, and laying the foundation for a world-class marketing team

Day 60+: 

  • You will own the top of funnel experience at Recurrency, helping us to redefine what comprehensive GTM looks and feels like in the ERP space, and leading the charge to build Recurrency into a brand name.

Recurrency aims to ensure a diverse, inclusive, and welcoming work environment. 

Individuals seeking employment at Recurrency are considered without regards to race, color, religion, national origin, age, sex, marital status, ancestry, physical or mental disability, veteran status, gender identity, or sexual orientation.

Technology

Our stack:

  • Python (Flask, PyTorch)
  • React (with TypeScript)
  • SQL
  • Docker
  • AWS
  • Heroku
  • MongoDB

See more jobs at Recurrency

Apply for this job