Technical Lead Remote Jobs

114 Results

+30d

Technical Lead-Search

Dodge Data & AnalyticsHamilton, NJ Remote
sqlDesigngitjava.netelasticsearchangularjenkinspythonredux

Dodge Data & Analytics is hiring a Remote Technical Lead-Search

Who We Are:

Dodge Construction Network leverages an unmatched offering of data, analytics, and industry-spanning relationships to generate the most powerful source of information, knowledge, insights, and connections in the commercial construction industry. The company powers four longstanding and trusted industry solutions—Dodge Data & Analytics, The Blue Book Network, Sweets, and IMS—to connect the dots across the entire commercial construction ecosystem. Together, these solutions provide clear and actionable opportunities for both small teams and enterprise firms. Purpose-built to simplify the complex, Dodge Construction Network ensures that construction professionals have the information they need to build successful businesses and thriving communities. With over a century of industry experience, Dodge Construction Network is the catalyst for modern commercial construction.

To learn more, visit: construction.com

About the Role:

Dodge Construction Network (DCN) is looking for a Technical Lead to be part of the team. You will be responsible for designing and developing a high-performance application. You will be working with a team of developers to create best practices and deliver software at pace. You will engage in technical discussions with the broader engineering team and day-to-day guidance for an offshore team in India.

As the Technical Lead on the team, you will define, design and implement key initiatives in building the new Search features that, build a robust, scalable model development, validation and implementation. To be successful, you'll be partnering with product, user experience, data platform and other engineering teams to identify, define and build elegant solutions. You'll have the opportunity to unlock the power of data through search, enabling customers to answer critical questions and uncover valuable insights that will drive their success.

What you’ll do:

  • To support the rollout of our product search, discovery and recommendations engine, you will be tasked with building multiple integrations with different databases and services. You build the scalable, fault-tolerant systems and APIs that host our core business logic.
  • Work on greenfield projects such as a new pipeline for ingesting clickstream data to better understand our users.
  • Create the High-level Design documents and lead the team in producing Detailed Design documents.
  • Work as part of our software engineering team to improve the search experience using large data sets.
  • Build reusable code and libraries for future use.
  • Work in boosting answer quality by meeting the challenges such as lexical gap, semantic text understanding, and data sparsity.
  • Craft new ranking features and optimizing existing ones to enhance relevance metrics.
  • Develop an algorithm framework to support diversified ranking features.
  • Optimize application for maximum speed and scalability.
  • Proven skills as a technical expert and team leader in an IT development environment.
  • Mentor and coach development teams; providing expert advice and acting as a “go-to” expert/guru for the development team. These developers are located in India and North America.
  • Being able to organize and participate in code reviews for developers, recommend design improvements and establish guidelines to a high level of standard.

What you’ll bring:

  • 7+ years of proven experience in web application development (.NET Core preferred).
  • Expert in Cloud Technology with the preferred platform of AWS.
  • 5+ years experience in search technologies (Elasticsearch / SOLR).
  • Proficiency in building high availability, a distributed application using Microservices.
  • Proficiency in Statistics, Big Data, SQL, Website Analytics, ElasticSearch, Machine Learning, Artificial Intelligence.
  • Hands-on experience in one or more of the following areas: Search Engine, Recommender System, Distributed System, Information Retrieval and Machine Learning.
  • Work with a variety of web APIs and developed search services using at least one modern language such as .NET Core/C# or Java, and high-level scripting languages like Python or Perl.
  • Proficiency in architecting data structures in Lucene for big data searching. Ability to search large datasets quickly to return data.
  • Good experience in query languages and writing complex queries with joins that deals with a large amount of data.
  • Computer Science fundamentals in data structures, algorithm design, and complexity analysis.
  • Interest in Search, Machine Learning, and Natural Language Processing.
  • Experience in Search, A/B experimentation, Distributed Computing, Data Analysis, Information Retrieval.
  • Experience presenting complex technical information in a clear and concise manner to a variety of audiences.
  • Hands-on experience in software deployment tools like Jenkins, Git, Bitbucket, Jenkins.
  • Working knowledge of technologies Angular + Redux is a plus.
  • Strong communication skills with the ability to interface with Software Development teams and Product Management.
  • Excellent analytical and problem-solving skills.


We are committed to leveraging the talent of a diverse workforce to create great opportunities for our business and our people. EOE/AA. Minority/Female/Sexual Orientation/Gender Identity/Disability/Veteran

See more jobs at Dodge Data & Analytics

Apply for this job

+30d

Technical Lead

Curriculum AssociatesRemote, United States
Bachelor's degreesqlsalesforceDesign.netcssjavascript

Curriculum Associates is hiring a Remote Technical Lead

Description

Summary:

Take one of the most innovative educational technology brands to the next level by becoming part of our rapidly growing organization.Curriculum Associates is seeking a highly qualified Technical Lead to serve as a leader in the Business Systems team within the Information Technology department.

The individual will lead the development, operations, and support of our technical aspects of our business applications. This position will be responsible for managing our custom web applications & Salesforce.com development team. The candidate will be highly experienced development manager providing technical expertise throughout the Software Development Life Cycle (SDLC). This position will work closely with a team of business analysts, technical architects, and business stakeholders, to develop and execute on application roadmap.

 Impact you’ll have:

  • Lead all aspects of software development work within business systems
    Implement best practices/standards across the full application lifecycle (i.e., design, development, change control, UAT, deployment and support).
    Manage and coach a dedicated team of development professionals on technical matters including code reviews and design.
    Lead technical innovation and automation for applications within our technology stack
    Organize technical teams, distribute work, and monitor progress, quality assurance and performance, in a multidisciplinary team environment.
    Research, recommend and implement upgrades to technical stack and platform (.NET Framework, IIS, SQL Server, etc.) in collaboration with the IT Infrastructure team.
    Responsible for release management (migration, refreshes, version control and deployment).
    Assist project managers by identifying project milestones, tasks, dependencies, resources, estimates, issues, risks and providing regular project status reports

What we’re looking for:

  • 7+ years' experience architecting and developing ASP.NET/C# web applications using traditional n-tier architecture.
  • 2+ years as a development lead in a fast-paced environment.
  • 5+ years of development on the Salesforce platform.
  • 2+ years in Salesforce development including APEX Classes, LWC), Triggers, Workflows, Validations, and Visualforce pages.
  • 6+ years of SQL Server development experience, including SQL Server Integration Services (SSIS), T-SQL, stored procedures, etc.
  • 2+ years of ASP.NET web framework including the Web Forms and MVC frameworks.
  • 3+ years building and integrating web services (SOAP, REST, JSON, XML).
  • 5+ years of integration platforms, protocols, standards, languages, and formats (e.g., iPaaS, SSIS, SFTP, SOAP, REST, JSON, XML, etc.).
  • 3+ years of web technologies (HTML, CSS, JavaScript). relational databases (SQL Server), and cloud application architecture (Salesforce).
  • 2+ years implementing version control with GitHub or equivalent.

Must have:

  • Bachelor's degree in Computer Science or a related field

See more jobs at Curriculum Associates

Apply for this job

+30d

Technical Lead, Order Fulfillment

BrightspeedCharlotte, NC, USA, Remote
5 years of experienceDesignazurejava

Brightspeed is hiring a Remote Technical Lead, Order Fulfillment

Company Description

Company Description

At Brightspeed, we are reimagining how people live, work, play and connect by providing fast, reliable internet connections and an awesome customer experience in twenty states throughout the Midwest and South.

Backed by funds managed by Apollo Global Management our vision is to accelerate the upgrade of copper to fiber optic technologies, bringing faster and more reliable internet service to many rural markets traditionally underserved by broadband providers, while delivering best-in-class customer experience.  

Be a part of the team that will make this vision a reality….designing and building a world class fiber network and creating a customer experience second to none.

Check us out on the web!  

Job Description

We have an exciting opportunity for a Technical Lead, Order Fulfillment, to lead E2E system solutions for the Brightspeed telecom suite of applications. As a key leader on our IT team, you will be responsible for system solutions in the areas of order fulfillment orchestration, inventory, provisioning, and billing domains. In this exciting role, you will be challenged with the opportunity to lead the team in every aspect of the customer order fulfillment process across the entire order provisioning life cycle.

As the Technical Lead, Order Fulfillment, you will have a deep technical background building scalable solutions to support complex business processes. If you are passionate about leading a team in migrating applications in Order Fulfillment space, perform efficient execution and delivering operational excellence, Brightspeed would be the perfect place for you!

As the Technical Lead, Order Fulfillment, your responsibilities will include:  

  • Define the roadmap, understand the E2E process in migrating provisioning applications from one platform to another, lead the team to achieve the business goals and identify solutions for any problems that come on the way operationally
  • Lead the team for the solutions put forth by Architects for optimal performance, scalability, and stability
  • Define processes and ensure the team follows the process to meet the KPIs set forth for the team
  • Work closely with the senior management, analyzing long-term business goals and suggesting ways the organization might achieve these goals with technology
  • Guide others to assess system usage trends and identify potential performance constraints with inter-system processes

#LI-RD1

Qualifications

WHAT WILL CATCH OUR EYE:

  • BS degree in Computer Science or equivalent
  • 12+ years of experience in software engineering with at least 5 years of experience in leading a team of 5 or more in telecom domain
  •  8+ years of experience in Java microservices development including the ability in troubleshooting various environment issues
  • 4+ years of experience with Micro Services and domain driven design
  • 3+ years of experience with one of the major cloud providers GCP, Azure or AWS.
  • Experience leading solution architecture lifecycle including concept, design, prototyping, integration, testing, and production release
  • Experience working in Telecom provisioning/billing and Fiber solutions
  • Experience implementing telecom products and services such as Voice/VOIP, Broadband services
  • Experience implementing BPM/Workflow/Orchestration tools
  • The ability to operate in a fast-paced environment with laser focus on delivering results
  • Self-driven, detail-oriented, and skilled in managing multiple clients, stakeholders, and cross-functional projects
  • The ability to exercise judgement in methods, techniques, and evaluation criteria for obtaining results
  • Provide industry knowledge, experience, and best practices to help the team stay ahead of the curve in keeping our technology stack cutting edge

BONUS POINTS FOR:

  • Java and Cloud (GCP/Azure/AWS) Certifications
  • Experience in FTTP provisioning and activation domain

 

Additional Information

WHY JOIN US?

We aspire to contemporary ways of working.

We are committed to being a leader in defining a new way to work because we recognize the changing mindset of today's workforce. We meet you where you are...wherever you are, by providing sensible remote and hybrid work arrangements. Why? Because our purpose is to reimagine how people work, learn, play and connect!

We offer competitive compensation and comprehensive benefits.

Our benefits and paid time off programs reflect our underlying belief in promoting overall wellness through physical, emotional and financial health. We are committed to building a team as diverse as the customers we serve.

Diversity, equity and inclusion are at the center of our grounding belief in Being Real. 

When we bring our authentic selves to work, everyone is better as a result. A diverse team helps us be fierce advocates for more accessible, inclusive and high-quality internet, because we believe doing so promotes equity in the communities we serve.

Brightspeed is an Equal Opportunity Employer

Please be advised that Brightspeed (Connect Holding LLC) requires its employees to be fully vaccinated against COVID-19, subject to the Company’s legal obligations including potentially accommodating an employee’s sincerely held religious beliefs or medical condition.

See more jobs at Brightspeed

Apply for this job

Shopify is hiring a Remote Technical Product Lead/Senior Product Lead, Multiple Teams (Remote, North America)

Company Description

Shopify is the all-in-one platform that powers millions of entrepreneurs worldwide. We help people achieve independence by making it easier to start, run, and grow their business. We believe the future of commerce has more voices, not fewer, so we’re reducing the barriers to business ownership to make commerce better for everyone. 

Shopify has always been a massive experiment - a place where you can unleash your curiosity, your passion for craft, and your drive to solve hard problems surrounded by strong teams. Shopify is now working permanently 100% remote, and we’re working towards a future that is Digital by Design. That location you see above? Consider it merely an example of hundreds of potential locations across North America where Shopify is hiring for all of our product teams.

Job Description

Shopify is hiring Technical Product Leads across all of our product teams!

Technical product leadership at Shopify is a central role that you will bring your technical product craft expertise and people leadership skills to every day. You’ll work with Engineering, UX, and other cross-functional teams to decide what products we build to solve complex merchant problems. Technical Product Leads take a player-coach position to unite all aspects of a product under a single, cohesive vision. They are curious, passionate, and entrepreneurial. They have founded their own companies, have deep technical expertise, launched successful products, and established a track record of getting things done at scale.

Qualifications

You could be who we are searching for if you have:

  • More than five (5) years of experience as a Technical Product Lead or Principal/Senior Technical Product Manager at modern tech, consumer-facing app, and/or SaaS companies.
  • At least two (2) years of people management experience in a product lead or product manager capacity.
  • Been responsible for performance management, have navigated tough conversations with direct reports, and you feel comfortable supporting product managers to achieve their career goals. 
  • Experience leading the definition, building, and shipping of complex technical products at scale. 
  • Experience creating long-term product strategy and defining success metrics for your product areas.
  • Experience collaborating with and inspiring engineering, data, UX, and other teams to create compelling technical patterns, design systems, and shared features.
  • Genuine user empathy and passion for solving their most complex problems with the products you ship.
  • Skills to drive ‘build, partner, or acquire’ decisions for your product area.
  • ​​​​​​Experience providing feedback and inputs in technical and architectural design.
  • The ability to distill technical concepts to business users and vice versa.
  • An entrepreneurial mindset - you must be comfortable rolling up your sleeves, thriving in ambiguity, and getting the work done.
  • A talent for storytelling. Experience influencing key technical and non-technical stakeholders, driving buy-in for your ideas, and telling exceptional stories around why and what product you are building.

Nice to have:

  • Experience with APIs, SDKs, and/or building for developers or developer platforms.
  • Computer Science or other technical post-secondary education. 
  • Coding experience or technical knowledge of coding languages.
  • Experience building and shipping products in the ecommerce space.
  • Founder or tech start-up experience. 

Additional Information

Shopify is growing! This posting will remain published as we hire for multiple teams.

Shopify is now permanently remote, and we’re working towards a future that is digital by design. That location you see above? Consider it merely an example of hundreds of potential locations Shopify is hiring. Learn more here:https://www.shopify.com/careers/work-anywhere

Our belief is that a strong commitment to diversity & inclusion enables us to truly make commerce better for everyone. We encourage applications from Indigenous peoples, racialized people, people with disabilities, people from gender and sexually diverse communities, and/or people with intersectional identities. Please take a look at our Sustainability Reports to learn more about Shopify’s commitments to our communities, and our planet.

At Shopify, we understand that experience comes in many forms. We’re dedicated to adding new perspectives to the team - so if your experience is this close to what we’re looking for, please consider applying.

See more jobs at Shopify

Apply for this job

+30d

Technical Lead - Java

SquareOslo, Norway, Remote
5 years of experienceuiapijavadockerangularAWS

Square is hiring a Remote Technical Lead - Java

Company Description

TIDAL is a global music streaming company with a mission to provide financial empowerment to artists around the world. The settlement team is in the center of this initiative as we calculate and settle royalties to artists around the globe. The team works with the latest tech to provide industry defining payouts such as the recently launched User Centric Model. We work with our counterparts in New York and San Francisco with the tech team sitting in Oslo/Europe.

As a Technical Lead, you ill join our Nexus Settlement team in Oslo. We make use of Amazon WebServices (AWS) such as Athena, Glue, DynamoDB and S3, RDS. Our team uses Java including frameworks like Apache Spark for ETL running on Databricks, Spring Boot for the RESTful API (Docker) and React for GUI development. We always evaluate the latest technologies and we have the freedom to choose the right technology to solve the task.

Job Description

You Will:

  • Lead and promote cooperation with other teams and departments when needed
  • Advocate and implement improvements to the software development process and be an advocate for excellent coding standards and reviews
  • Help build a great team
  • Use your experience in software development and technical leadership to coach teammates on best practices, technology and architecture decisions
  • You will lead a development team of 5 – 8 developers, be a great team player, be enthusiastic, and take part in the sharing culture in the team.

Qualifications

You Have:

At least 5 years of experience as a Java developer, with a few years experience as tech lead and you are eager to work with the latest big data technologies with ambition to go full stack.

  • Experience building RESTful APIS using Spring Boot and Java
  • Experience with big data platforms and building ETL pipelines with Spark
  • Professional knowledge of SQL.
  • Experience working with cross functional teams.
  • Some experience with UI development with React
  • An advantage if you also know Spark, Databricks, Spring boot, React or Angular

Additional Information

What we offer:

  • Great compensation package including stocks in Block (Square), learning opportunities and a dedicated learning budget, deep workweeksever quarter to focus, and several other perks.
  • Technology: You will work in a tech-oriented environment with a team of experienced developers who are passionate about technology
  • Diverse team: Our strength is diversity, and we are proud to say that we represent more than 30 different nationalities.
  • Stay energized: We provide snacks, fruit, and food at the office.
  • Share ideas: TIDAL tech talks and Show and Tell sessions in-house.
  • Social: We host intimate concerts in the office, and we have a summer/ Christmas party. We also have a microbrewery team that serves end- of-month beer at the office.

We’re working to build a more inclusive economy where our customers have equal access to opportunity, and we strive to live by these same values in building our workplace. Block is a proud equal opportunity employer. We work hard to evaluate all employees and job applicants consistently, based solely on the core competencies required of the role at hand, and without regard to any legally protected class.

We believe in being fair, and are committed to an inclusive interview experience, including providing reasonable accommodations to disabled applicants throughout the recruitment process. We encourage applicants to share any needed accommodations with their recruiter, who will treat these requests as confidentially as possible. Want to learn more about what we’re doing to build a workplace that is fair and square? Check out our I+D page

Block, Inc. (NYSE: SQ) is a global technology company with a focus on financial services. Made up of Square, Cash App, Spiral, TIDAL, and TBD, we build tools to help more people access the economy. Square helps sellers run and grow their businesses with its integrated ecosystem of commerce solutions, business software, and banking services. With Cash App, anyone can easily send, spend, or invest their money in stocks or Bitcoin. Spiral (formerly Square Crypto) builds and funds free, open-source Bitcoin projects. Artists use TIDAL to help them succeed as entrepreneurs and connect more deeply with fans. TBD is building an open developer platform to make it easier to access Bitcoin and other blockchain technologies without having to go through an institution.

See more jobs at Square

Apply for this job

Shopify is hiring a Remote Senior Lead - Technical Support (Remote, Americas)

Company Description

Shopify’s mission is to make commerce better for everyone. From building a new product feature for our commerce platform, to helping a merchant troubleshoot an issue over the phone, we want to empower our ecosystem through our work.

Having a unified vision, a north star, is vitally important to ensure that we are all headed in the same direction. No matter the size or experience, we want to power every merchant’s experience. This is why we’re all here.

Shopify is now permanently remote, and we’re working towards a future that is digital by design. That location you see above? Consider it merely an example of hundreds of potential locations across North America where Shopify is hiring. Learn more here: https://www.shopify.com/careers/work-anywhere

Job Description

Works With:The Senior Support Lead interacts with other Senior Support Leads, Support Advisors, Specialists, and Experts,  Product Development and Product Management Leads, Workforce Planning, Training and Mentoring, Support Data, and Talent Business Partners regularly. 

Role Overview: In Support, our product is people. This includes our merchants, our team, and the success of the entire company we work for. We help people make money. We believe that human conversations help people make lifelong connections to our company. Every interaction with our merchants is an opportunity to do more than answer questions; we create memorable experiences by adding value to their businesses.  

As the Senior Lead of Technical Support you will be a lead of leads, leading teams of Technical Support Specialists responsible for providing in-depth troubleshooting and advice to Support Advisors and regional escalation teams.  Your teams will drive efforts to develop knowledge, content, and tools to enable regionals and global teams to be self-sufficient. A priority will be to leverage product and merchant insights to advise product and support on improvements to better merchant experiences.

The Senior Lead must be a strong leader who models great decision making by applying leadership and technical expertise,  Shopify context, and analyzing a range of inputs, unknowns and risks. The Senior Lead is a strong people development leader and coach who actively manages performance and consistently raises the bar of their leaders by fully investing in their development. We are looking for someone who knows how to be a strong partner, leader, and drive home results. 

Responsibilities and Duties:

  • Accountable for team performance, including maintaining SLOs and service quality for support to merchants and internal teams.

  • Create and maintain strong networks across the organization and leverage insights to anticipate the needs of the business.

  • Owns the development and execution of strategies and programs to improve merchant experience and adapt to changing business needs.

  • Leverages product insights and merchant frustrations to collaborate with product and support teams to improve merchant experience with both the product and support. 

  • Identifies opportunities to enable regional support teams through improvements in knowledge content, troubleshooting tools and procedures. 

  • Considers how the work of their team will impact merchants, employees, and Shopify, and weighs all three in their decision making.

  • Leads a team culture and environment that embodies Shopify’s values and sets an example in delivering on our mission.

  • Owns and ensures execution of performance management, impact assessments, people development, and delivery of high-impact outcomes through direct reports and their teams.

  • Developing leadership in your team, including setting high standards for leaders, driving  succession planning and talent development efforts.

  • Encourages and enables their direct reports to work collaboratively and cross-functionally both within Support and with other internal stakeholders.

Qualifications

  • Experience leading merchant/customer facing teams at scale, including as a Lead of Leads, in a Technical Support Environment.
  • Experience working with Product and/or Engineering teams.

  • Experience with service design and continuous improvement practices.

  • Leads by example, making sound decisions quickly, and communicating effectively.

  • Makes decisions based upon analysis, wisdom, experience and judgment, to solve complex issues affecting the team.

  • Actively manages performance, engages appropriate stakeholders at the right time.

  • Strong interpersonal skills.  Able to relate well to all levels of individuals to defuse even high tension situations comfortably through diplomacy and tact.

  • Organizational agility. Knowledgeable about how organizations work, knows how to get things done both through formal channels and informal networks, understands the origin and reasoning behind key policies, practices, and procedures.

  • Can act in ways that seem contradictory. Is flexible and adaptable when facing tough calls, can set strong but reasonable standards, and can act differently depending on the situation. Overall is seen as balanced despite the conflicting demands of the situation.

Additional Competencies:

  • High level of self-awareness and ownership.

  • Curious and resourceful – seeks to understand.

  • Strong analytical skills and the ability to leverage data for informed decisions.

  • Effectively copes with ambiguity, change, can comfortably handle risk and uncertainty, isn’t upset when things are up in the air.

  • Strong Business Acumen.

  • Effective conflict management skills.

  • Clear communicator, brings out the best in people, sets stretching objectives, and is good at establishing clear directions.

Additional Information

We know that applying to a new role takes a lot of work and we truly value your time. 

At Shopify, we understand that experience comes in many forms. We’re dedicated to adding new perspectives to the team - so if your experience is this close to what we’re looking for, please consider applying. Robert Carlson is the hiring manager and she is looking forward to reviewing your application and cover letter. 

Closing date: April 22nd at 11:59pm EDT. Successful candidates can expect to hear back from us. 

#LI-TP3 #LI-REMOTE

 

Shopify is now permanently remote, and we’re working towards a future that is digital by design. That location you see above? Consider it merely an example of hundreds of potential locations Shopify is hiring. Learn more here:https://www.shopify.com/careers/work-anywhere

Our belief is that a strong commitment to diversity & inclusion enables us to truly make commerce better for everyone. We encourage applications from Indigenous peoples, racialized people, people with disabilities, people from gender and sexually diverse communities, and/or people with intersectional identities. Please take a look at our Sustainability Reports to learn more about Shopify’s commitments to our communities, and our planet.

At Shopify, we understand that experience comes in many forms. We’re dedicated to adding new perspectives to the team - so if your experience is this close to what we’re looking for, please consider applying.

See more jobs at Shopify

Apply for this job

+30d

SaaS Technical Lead

MicroStrategyCiudad Autónoma de Buenos Aires (CABA), Argentina, Remote
agilemarketosqlsalesforceDesignjqueryscrumapigitjavaangularjenkinsjavascript

MicroStrategy is hiring a Remote SaaS Technical Lead

Company Description

MicroStrategy transforms organizations into intelligent enterprises through data-driven innovation. We match smart people to dynamic projects and technologies that truly challenge their talents. Curious and creative in outlook, our success is built on the talent and energy of smart and driven people. MicroStrategy (Nasdaq: MSTR) is a worldwide leader in enterprise analytics and mobility software. A pioneer in the BI and analytics space, MicroStrategy delivers innovative software that empowers people to make better decisions and transform the way they do business. We provide our enterprise customers with world-class software and expert services so they can deploy unique intelligence applications.

Job Description

The Role:The Technical Lead role is hands-on in designing, coding, enhancing and testing of custom SaaS applications to meet business process requirements. Working with other ITS team members and business leaders, this role will apply functional knowledge and technical expertise in the implementation and maintenance of SaaS applications. The candidate will have exceptional technical, analytical and problem-solving skills and be comfortable interacting with all levels of the organization. We are seeking a self-starter, with a bias towards action, who can recognize and make process improvement recommendations.

Your Focus:

  • Design, develop, configure, test and deploy solutions using Salesforce.Com, ServiceNow, FinancialForce, CPQ
  • Implement scalable solutions including continuous delivery, optimization, monitoring, release management and support the end-to-end release process.
  • Map functional requirements to Salesforce.com features and functionality.
  • Provide oversight to code reviews
  • Develop custom code using Visualforce/Apex/Lightning/JavaScript to create unique customer-based solutions
  • Develop integration processes using Salesforce Web Services API and third-party integration tools (Informatica, etc)
  • Implement solutions in an agile environment delivering high-quality code and configuration
  • Know when to use out-of-the-box functionality versus custom code
  • Develop and manage Workflows, Process Builder, Assignment rules, email templates, and all other declarative and programmatic features.
  • Customize custom objects, fields, reports, 3rd party apps etc. Handle mass imports and exports of data.
  • Understand and support security role maintenance, including role hierarchy, security profiles and access rights
  • Lead and support unit testing, integration testing and create test plans
  • Write technical approach and design documentation supporting business needs 
  • Work independently & on multiple projects against deadlines in a dynamic environment where consistently producing deliverables within agreed upon timelines is expected 
  • Manage the integration of applications connected to Salesforce.com, including but not limited to CPQ, ServiceNow, WorkDay, Marketo, DocuSign, Salesloft, etc.
  • Identify production risks and areas for improvement; prioritizes, designs and facilitates successful implementation and adoption of new processes.
  • Support the Business Operations team in cross-functional projects and strategic changes to systems and processes.
  • Collaborate with Business Operations, Information Technology and other business stakeholders to drive high levels of data integrity and operational reliability of our standardized business analytics, tools and processes.

Qualifications

Motivation, Innovation, Passion, Integrity, Teamwork, Customer-Focus

You should also bring the following:

  • Bachelor’s degree in Computer Science, Information Systems, Engineering, or related field
  • 3+ years of professional experience Developing on the Force.com platform
  • Salesforce.com CPQ or Platform Developer Certification preferred
  • Experience in Continuous Integration Tools (Git, Jenkins, Ant)
  • Hands-on Experience with Java, JavaScript, Visualforce, Apex, Lightning, JQuery, Angular, HTML/XHTML, XML, SQL
  • Demonstrated knowledge of object-oriented methodologies and approaches 
  • Demonstrated knowledge of relational databases, data modeling, database concepts and data management 
  • Ability to work independently and be proactive
  • Excellent written and verbal communication skills
  • Be able to work under pressure, multi-task, manage changing priorities and workload
  • Experience in software design, development, implementation and production support
  • Excellent team player able to work with cross functional teams
  • Additional background in ServiceNow FinancialForce, Community, CPQ, Marketo and other integrations a plus
  • Desired experience working in an Agile Framework (Scrum or Kanban)

See more jobs at MicroStrategy

Apply for this job

+30d

ETL Technical Lead

fulcrum worldwideCamden Ave, Campbell, CA, USA, Remote
tableausalesforceoraclepythonAWS

fulcrum worldwide is hiring a Remote ETL Technical Lead

Job Description

ETL Technical Lead

100% Remote Work

Duration: 6 Months

 

Required Skills

Preferably we are looking for 9+ years of experience candidate

Salesforce Marketing application

Amazon Aws services s3, Redshift and knowledge of EMR stack

Hands on Python

Oracle

Standard Unix Scripting

Tableau or Looker or Mod.

If you are willing to apply, then please send your updated resume along with below mentioned details:

Availability to Join:

Availability for the first Telephonic Interview:

Candidate must be authorized to work in the United States

Fulcrum is an Equal Opportunity Employer and is committed to maintaining a discrimination-free workplace

 

Additional Information

All your information will be kept confidential according to EEO guidelines.

See more jobs at fulcrum worldwide

Apply for this job

+30d

Technical Lead, Finance Engineering

ZscalerSan Jose, CA, USA, Remote
7 years of experienceagile10 years of experiencesqlsalesforcejavascript

Zscaler is hiring a Remote Technical Lead, Finance Engineering

Company Description

Zscaler (NASDAQ: ZS) accelerates digital transformation so that customers can be more agile, efficient, resilient, and secure. The Zscaler Zero Trust Exchange is the company’s cloud-native platform that protects thousands of customers from cyberattacks and data loss by securely connecting users, devices, and applications in any location. 

With more than 10 years of experience developing, operating, and scaling the cloud, Zscaler serves thousands of enterprise customers around the world, including 450 of the Forbes Global 2000 organizations. In addition to protecting customers from damaging threats, such as ransomware and data exfiltration, it helps them slash costs, reduce complexity, and improve the user experience by eliminating stacks of latency-creating gateway appliances. 

Zscaler was founded in 2007 with a mission to make the cloud a safe place to do business and a more enjoyable experience for enterprise users. Zscaler’s purpose-built security platform puts a company’s defenses and controls where the connections occur—the internet—so that every connection is fast and secure, no matter how or where users connect or where their applications and workloads reside.

Job Description

Position: Technical Lead, Finance Engineering
Location: Remote within United States

The Technical Lead will provide advanced technical insights and lead a team of developers to deliver projects and enhancements across finance modules. Also, will work with the Project/Program Manager, Business Analysts/Architects, Support team, and Engineering to provide advanced technical solutions on the NetSuite platform.

Responsibilities/What You’ll Do

As Technical Lead, your primary responsibilities will be to:

  • Platform SuiteBuilder customizations including custom fields, custom record types, custom transactions, and segments
  • Addressing business process gaps through customization tools such as workflowsand SuiteScript
  • Developing or assisting in integrations between 3rd party systems and NetSuite
  • Developing solutions that involve custom records, custom transactions, automations, scripts and workflows
  • Track project and task assignments, and follow up with the cross functional on outstanding items
  • Respond to support requests that require scripting and other advanced customizations
  • Assist and development analytics using on-platform tools such as saved searches and reports as well as through custom methods
  • Lead the Technical Roadmap for the NetSuite Platform

Qualifications

Qualifications/Your Background

  • At least 10 years of experience with NetSuite
  • At least 7 years of experience with NetSuite SuiteScript (1.0 or 2.0) and/or SuiteFlow (workflow builder)
  • Experience in SuiteBuilder, SuiteFlow, SuiteScript, SuiteCloud Development Framework.
  • Experience with web services (REST, SOAP).
  • Exposure to Salesforce, Coupa, Concur, Adaptive Planning is a plus.
  • Experience developing integrations between NetSuite and 3rd party systems
  • Understanding of Finance Processes for Order to Cash, Procure to Pay, Record to Report is a plus.
  • Knowledge of any of the following: JSON, JavaScript, HTML, or SQL is a plus
  • Any background in other CRM, ERP, or Accounting software is a plus
  • NetSuite SuiteFoundation Certification is a plus.

Additional Information

All your information will be kept confidential according to EEO guidelines.

#LI-YC2 

What You Can Expect From Us:

  • An environment where you will be working on cutting edge technologies and architectures
  • A fun, passionate and collaborative workplace
  • Competitive salary and benefits, including equity

Why Zscaler?

People who excel at Zscaler are smart, motivated and share our values. Ask yourself: Do you want to team with the best talent in the industry? Do you want to work on disruptive technology? Do you thrive in a fluid work environment? Do you appreciate a company culture that enables individual and group success and celebrates achievement? If you said yes, we’d love to talk to you about joining our award-winning team. 

Additional information about Zscaler (NASDAQ: ZS ) is available at https://www.zscaler.com

Zscaler is an equal opportunity employer. We celebrate diversity and are committed to creating an inclusive environment for all employees.

See more jobs at Zscaler

Apply for this job

+30d

Data Governance, Technical Lead

Procore TechnologiesRemote, OR, Remote
tableausqlDesignpythonAWS

Procore Technologies is hiring a Remote Data Governance, Technical Lead

Job Description

We’re looking for a Data Governance Technical Leadto join Procore’s Data Governance Program Office. In this role, you’ll interact and partner closely with various stakeholders across Procore to perform data life cycle monitoring activities, partner and work directly with security, engineering teams, and data stewards to create/formalize governance frameworks that enable data privacy/protection requirements (in motion, in use, and at rest).

As a DG Technical Lead, you will also collaborate to define data management process activities and steps to implement standards that ensure tangible governance configurations for data and tools are adhered to and maintained. If you demonstrate strong leadership, prioritization, and communication skills, and you are a team player with a natural curiosity about the ever-evolving data regulatory and data management landscape —we’d love to hear from you.

This position will report to our Senior Director of Enterprise Data Governance, and have strong partnerships with our GRC, Data Privacy, P&T Security, and Legal teams. This role can work remotely from any U.S location or be based in our headquarters in Carpinteria, CA office. We’re looking for someone to join us immediately.

What you’ll do: 

  • Develop, socialize, and implement data governance practices related to data quality measurement, analysis, testing and remediation
  • Ensuring that metadata critical to data governance is captured, accessible, and standardized in a universal metadata model format
  • Facilitate data Domain/Sub Domain definition, ratification, and socialization
  • Build consistent practices and create/ratify common processes for data definition creation (workflows), ratification and storage, data lineage mapping, metadata and master/reference data management, data quality, and “state of governance” reporting
  • Lead data inventory efforts to create a comprehensive and sustained view of all Procore data and where these data reside within organizational systems.
  • Map data policies to data sets; ensure broad socialization of policies with dataset owners/users and facilitate the implementation and enforcement of policies throughout
  • Lead/facilitate the implement of data retention/deletion policies and procedures across data domains
  • Support the data and IT asset categorization efforts, including data lineage mappings, new application classifications and applications in development, ensuring adherence to data policies
  • Assess and identify data access personas relative to data classifications, categorizations, business use justification, etc.
  • Identify, establish, and monitor key data governance & risk metrics
  • Partner with functional DG workgroups to implement governance practices where none exists and refine standards/processes where teams do exist

What we’re looking for:

  • 6+ years of Data Governance, Data Quality and/or Metadata management experience
  • Proficiency with programming language such as SQL, SAS, Python and/or R
  • Strong experience with current data engineering tools such as Snowflake, AWS, dbt, etc.
  • Experience with data management and visualization applications (i.e., Alation, Unity Catalog, OneTrust, Tableau, GitHub)
  • Advanced knowledge of data management practices, data architecture, data life cycle monitoring activities, data quality and data governance tools and artifacts
  • Strong knowledge of data governance practices, business and technology issues related to management of enterprise information assets and approaches related to data protection
  • Experience in design of metrics and measures for monitoring effectiveness of controls for data governance and data risk
  • Project management experience with strong prioritization, organization, and problem-solving skills

Additional Information

If you'd like to stay in touch and be the first to hear about new roles at Procore, join our Talent Community.

About Us

Procore Technologies is building the software that builds the world. We provide cloud-based construction management software that helps clients more efficiently build skyscrapers, hospitals, retail centers, airports, housing complexes, and more. At Procore, we have worked hard to create and maintain a culture where you can own your work and are encouraged and given resources to try new ideas. Check us out on Glassdoor to see what others are saying about working at Procore. 

We are an equal opportunity employer and welcome builders of all backgrounds. We thrive in a diverse, dynamic, and inclusive environment. We do not tolerate discrimination against employees on the basis of age, color, disability, gender, gender identity or expression, marital status, national origin, political affiliation, race, religion, sexual orientation, veteran status, or any other classification protected by law.

Perks & Benefits

You are a person with dreams, goals, and ambitions—both personally and professionally. That's why we believe in providing benefits that not only match our Procore values (Openness, Optimism, and Ownership) but enhance the lives of our team members. Here are just a few of our benefit offerings: generous paid vacation, employee stock purchase plan, enrichment and development programs, and friends and family events.

See more jobs at Procore Technologies

Apply for this job

+30d

Technical Lead (Full-Stack)

NexthinkZürich, Switzerland, Remote
agileDesigngraphqljavadockerkubernetes

Nexthink is hiring a Remote Technical Lead (Full-Stack)

Company Description

Hi, we’re Nexthink. We’re not just the leader in the digital employee experience category, we invented the category. Our solutions combine real-time analytics, automation and employee feedback across all endpoints to help IT teams delight people at work. Our cloud-native platform pinpoints issues and solutions, automates response, and helps companies continuously improve their employees’ experience, making them more productive, efficient, and happy at work. We have millions of endpoints deployed, we’ve surpassed $100M in ARR, and we’ve recently secured $180M in Series D financing for a company valuation of $1.1B, but we’re just getting started.

Job Description

We are looking for a Tech Lead with a strong desire to learn and innovate – you help challenge the status quo and you are determined to help Nexthink stay on the leading edge of digital employee experience. The candidate should be heavily motivated by both the product and technology stack. This is a unique opportunity to design and build distributed systems at scale.

Inside the Nexthink Engineering department, you will work on Engage, a revolutionary solution to break down the wall between IT and employees, and to better align the business to increase productivity and deliver higher end-user satisfaction with IT. The current goal of this team is to build the next generation Engage 2.0 using a cloud-native, open-source, stack based on a microservices architecture.

Nexthink’s mission is to delight people at work and your contributions will impact the work-life of millions of workers. As a Technical Lead at Nexthink, we expect you to be a strong communicator and demonstrate technical excellence to help and guide the team in delivering on their commitments. You will participate in all stages of software development and collaborate with different teams.

You are highly motivated, result-driven, and detail-oriented. You have a high sense of product ownership, constantly learning and enhancing your skills (both hard and soft). You are familiar with the concepts and patterns described in the Reactive Manifesto, and terms such as CAP theorem, consensus protocols, strong vs eventual consistency, backpressure, bulkheading, circuit breaker, split-brain, and event-sourcing are your bread and butter. You are pragmatic, open to feedback, accountable, and a team player.

This is a once in a lifetime opportunity to be part of an extremely dynamic, Silicon Valley like, unicorn company. We look forward to meeting you!

Job Duties:

  • Manage the day-to-day activities of the team
  • Actively collaborate with different partners or stakeholders and motivate the team to achieve organizational goals
  • Conduct regular (weekly) 1-1s with each team member
  • Anticipate business risks and requirements and accurately translate them into solutions and projects (a.k.a., project management)
  • Oversee and contribute to the overall product’s architecture and design
  • Design, implement, test, deliver and validate features
  • Oversee L3 support requests
  • Work with the agile iterative/incremental mindset and best practices and participate actively in the different ceremonials

Qualifications

  • B.S. or Master in Computer Science
  • 7+ years of experience building production software systems, with at least 4+ years as Senior Software Engineer
  • Experience defining system architectures and exploring technical feasibility trade-offs
  • Expertise in full stack development in at least one modern programming language and familiarity with different datastores
  • Experience with Kubernetes, Docker, Kafka, GraphQL, Java, and React is highly valuable
  •  Proven ability to learn new languages and technologies, and lead others in acquiring new skills
  • Excellent communication (both written and oral) in English and teamwork skills. Experience with speaking at technical conferences is valued

Additional Information

We are 800+ employees strong in 21 countries across 8 different time zones speaking 60+ languages. We are positive, we get things done, we keep growing, and we are one team, we are Nexthink. We believe actions are stronger than words when it comes to diversity, inclusion, and equity in the workplace. Nexthinkers are multinational and multilingual, and come from all walks of life. We are committed to hiring a genuinely representative workforce that can create solutions and foster innovation for the modern digital employee experience.

See more jobs at Nexthink

Apply for this job

+30d

Oracle Fusion Technical Support Lead

TMS LLCJersey City, NJ, USA, Remote
salesforceoracleDesignapiAWS

TMS LLC is hiring a Remote Oracle Fusion Technical Support Lead

Company Description

TMS is a technology company, that believes in democratization of technology. We are driven by passion for defining, designing and development of technology and solutions for residential and commercial applications.TMS is a technology company, that believes in democratization of technology. We are driven by passion for defining, designing and development of technology and solutions for residential and commercial applications.

Job Description

Technical must-have
Very strong technical experience with Oracle Fusion products especially around SCM &  Finance, CPQ. Experience with Manhattan WMS integrations would be a plus.
Very strong technical experience with API, FBDI loads, BIP , BICC, ESS jobs, Configuration e.t.c
Very strong experience with Fusion-based integrations and integration design patterns.
Very strong experience with performance monitoring, operational monitoring in Oracle Fusion.
Must have strong business acumen and should be able to present and build technology solutions taking into consideration the existing business processes and the need to transform them. Must be data driven in all aspects of solutioning including performance tuning.
Knowledge and understanding of SDLC best practices including automated code/configuration build and deployment lifecycles as well as code quality and unit tests.  

Coverage Areas:

o Oracle PaaS
o Integrations
o Oracle Functional
Incident Triaging and Resolution coordination
o Ability to trace the flow to the source of the problem and engage appropriate tech folks for resolution
Service Request
o Ability to provide impact analysis as well as highlight potential issues while implementing - specially on the aspects of the feature not currently supported by Oracle & workaround impact

Enhancements & Upgrade
o Impact analysis on PaaS and other Oracle Fusion applications for enhancement work and facilitate test cases to retain transaction integrity
o Maintain KEDB & Workarounds DB for planning
o Manage Performance expectations.
Patches & Upgrades
o Socialize process across upstream and downstream constituents - SFCC, WMi
o Facilitate test cases to retain transaction integrity
o Continuous Automation
Projects & Backlog roll-out
Continuous Improvement to avoid incidents


Day to Day Responsibilities
Incident - System Non-Availability
o Oracle Fusion SaaS
Coordinate with Oracle on restoration
o Oracle PaaS
Coordinate with PaaS administrator
o Integration Points (Kafka, Kong, MQ, SOA/OSB/BPEL)
Incident - Performance deterioration
Incident - Reconciliation issues
Incident - Bug or Issue reported with standard functionality

o Oracle SaaS
o SOA
o Orders from Salesforce, Demandware
o MDM
o IBM MQ (integration related data)
o WMI (integration related data)
o BI / SCI Reporting (reporting environment or data not being available/fetched e.g., issues with MFT,
Cognos server on AWS etc.)
Service Request - Reports
Service Request - Patches and Upgrades
o Performance Testing after the event
Service Request - Functionality of SaaS environment
Backlog Management
o Enhancements
Regular user requests - usability & expected features. 
Regular limitations in systems detected and addressed.
Limitations that come post go live which needs to be addressed 
Related to volume
Business workflow - jobs tuning, scheduling

o Project Backlog
o New Projects
Prepare & share the prod Operational stats (SLA, Uptime etc)
Recommend changes to Prod & Non prod footprint 
o Based on load/volume/usage
Identify Areas of improvements
o Monitors, Tools. OMC
o Automation 

Additional Information

Additional Information

We are committed to creating a diverse environment and is proud to be an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, gender, gender identity or expression, sexual orientation, national origin, genetics, disability, age, or veteran status.All your information will be kept confidential according to EEO guidelines.

See more jobs at TMS LLC

Apply for this job

+30d

Migration and Modernization Technical Lead

Nordcloud FinlandHelsinki, FI; Jyväskylä, FI; Salo, FI; Oulu, FI; Kuopio, FI Remote
azurelinux

Nordcloud Finland is hiring a Remote Migration and Modernization Technical Lead

When you join Nordcloud, you become part of a rapidly growing company where you will set your career on track for outstanding achievement within a company that knows no limits. Our customers are large enterprises seeking to be part of #TheCloudRevolution and to benefit from the ability to innovate faster than ever.

We are now looking for an innovative Migrate and Modernize Technical Leadto join our team.

What we expect from you:

  • 5++ years of relevant experience
  • Established diverse, in-depth knowledge and experience during their multi-year professional career so far
  • Experience on large customer Cloud infrastructure and solutions (Azure/AWS/GCP)
  • Experience in Migration assessment
  • Experience in designing, planning, and leading Azure/AWS migrations

Soft skills:

  • Fluent English
  • Excellent communication skills and a business mindset
  • Influences functional strategy. Expert within the organization
  • Drives progress and pioneers with solutions in a way that can take the whole company onward
  • Requires specialized depth and/or breadth of expertise
  • Interprets internal or external business issues and recommends solutions/best practices
  • Solves complex problems; takes a broad perspective to identify solutions while anticipating potential problems
  • In addition to technical skills, expertise from applying cloud to at least one industry and application area (for example core business applications)
  • Experience and technical understanding of large-scale data center migrations

Hard skills:

  • Strong (Azure/AWS/GCP) platform experience
  • Network architecture and network security architecture experience
  • Migration automation tooling experience (ASR, Migrate, Cloudendure, Rivermeadow, or other)
  • Knowledge of ITSM CMDB data, ability to use available information for planning
    • Virtualization (Hyper-V, VMware, etc)
    • Windows Server and Linux administration
    • Active Directory administration
    • DB administration
    • Backup and DR systems

Our ideal candidate:

  • Can lead the work/environment in question as a whole, help other teams and customers to select the right technology/method for their use case, and act as an advocate for the topic
  • Acts as a lead architect/technology lead at a customer
  • Is able to lead work at multiple smaller customer organizations at the same time or a few smaller projects
  • Can actively facilitate and help customers come up with requirements instead of waiting for them
  • Can take into account the impact of customers' entire application landscape (underlying servers in designs)
  • Actively identifies new opportunities for
  • Capable of educating customers on best practices in Cloud and communicating solution offerings in a manner that customers understand the value within them
  • Has skills in at least one other architecture domain in addition to cloud infrastructure (applications, systems, data, security)
  • Has skills to assess customers current cloud strategy, solution, and /infrastructure, create gap analysis and improvement recommendation supporting migration strategy

Why Nordcloud as your next career move?

  • Lots of opportunities to develop your expertise and for professional growth. You get access to relevant training & knowledge sharing sessions to support the growth and work with a community of leading cloud professionals
  • Flexible working hours and freedom to choose your tools and ways of working
  • Wide range of benefits like extensive private health care and insurance, wellness benefits, a high-end laptop, and a smartphone of your choice.
  • Events & fun – besides all your interesting work assignments, feel free to enjoy our extra-curricular activities such as clubs, virtual coffees, after work, etc. And of course, we welcome new activities open-heartedly if you have anything in mind!

Learn more about #NordcloudCommunity. Get familiar with the technologies and projects we work on here.

Curious about what's behind the idea of setting up Nordcloud? Watch this video!

If you’d like to join us, please send us your CV or LinkedIn profile.

Please read our Recruitment Privacy Policy before applying. All applicants must have the right to work in the EU.

For candidates seeking a remote working setup: for remote, we mean that you must work from the local country.

About Nordcloud

Nordcloud is a European leader in cloud implementation, application development, managed services, and training. It’s a recognized cloud-native pioneer with a proven track record helping organizations leverage the public cloud in a way that balances quick wins, immediate savings, and sustainable value. Nordcloud is triple-certified across Microsoft Azure, Google Cloud Platform, and Amazon Web Services – and is featured in Gartner’s Magic Quadrant. Nordcloud has 10 European hubs, over 1000 employees and has delivered over 1,000 successful cloud projects for companies ranging from midsize to large corporates. Nordcloud has been an IBM company since early 2021.

We are digital builders born in the cloud. Joining Nordcloud is the chance of a lifetime to leave your mark on the IT industry!

#Li-remote

+30d

Technical Lead - Business Intelligence

MuteSixWork from Home Office - Remote, Chicago, Ill, United States, Remote
agiletableausqlsalesforceDesignazure

MuteSix is hiring a Remote Technical Lead - Business Intelligence

Company Description

Our Story

dentsu is a modern marketing solutions company that champions meaningful progress. Our mission is to help clients navigate, progress, and thrive in a world of change. Businesses rely on our integrated network of agencies and specialized practices to champion meaningful progress through creative, media, commerce, data, and technology. dentsu international comprises 66,000 diverse people in 143 countries, who are dedicated to teaming for growth and good.

Why Join Us?

We have a start-up feel with the backing of a large agency network. We help brands achieve tremendous competitive advantage. We thrive because we employ the best in the business.

Role Purpose

We are looking for a strong hands-on Business Intelligence Tech Lead to join our exciting Global BI team. This role reports to the Head of Reporting and Analytics. This is a unique opportunity to be involved in delivering leading-edge business analytics using the latest and greatest cutting-edge BI tools, such as cloud-based databases, self-service analytics and leading visualization tools enabling the company’s aim to become a fully digital organization.

Job Description

.You Are:

  • Experienced in cutting edge technology including MS Power BI, Asia Cloud, Data Analysis Expressions - DAX Financial data. Experience with enterprise data warehousing, financial, pricing and data lakes using Azure; Tableau a plus 
  • An excellent communicator who can turn business requirements into technical solutions understood by both technical and non-technical audiences
  • Motivated by a challenge with a delivery-minded,  can-do, “find a way” attitude
  • An experienced technical leader who is gifted at organizing, managing, and inspiring teams
  • A strong presenter and collaborator who can communicate all aspects of the job requirements, including the creation of formal documentation
  • Able to lead 2-3 global initiatives from end to end from analysis, design, execution, and reporting
  • Relentless in your quest for excellence
  • A creative problem-solver who is proactive and deadline-driven
  • Able to speak up confidently and with authority
  • Equipped to remain calm and focused under pressure

You Will:

  • Be the technical lead on various BI Projects including technical management of consultants, offshore
  • resources, Senior and Junior BI team members.
  • Lead the team of developers from both Data Engineering and Analytics team
  • Assign development tasks to developers and provide guidance
  • Work with business leads to lead technical discussions, provide technical solution
  • Collaborate with the BI Dev team members to evaluate, design, develop BI reports and dashboards according to functional specifications while maintaining data integrity and data quality
  • Apply best practices of data integration for data quality and automation
  • Work with business analysts to understand business requirements and use cases in order to write and assign technical stories and tasks
  • Work independently within guidelines, responsible for initiating, planning, executing, controlling, and implementation of projects using a formal project management and agile methodology
  • Work collaboratively with key stakeholders to translate business information needs into well-defined data requirements to implement the BI solutions
  • Coach, mentor, and provide  technical direction and training to other IT personnel
  • Work with Head of BI & Head of Analytics to develop and establish BI road Map/Vision

Qualifications

.

 

Qualifications – Experience and Education

 

You Have:

  • Experience in cutting edge technology including MS Power BI, Asia Cloud, Data Analysis Expressions - DAX Financial data. Experience with enterprise data warehousing, financial, pricing and data lakes using Microsoft Azure; Tableau a plus 
  • Strong advanced SQL and query optimization skills
  • Excellent communications skills and ability to turn business requirements into technical solutions
  • Demonstrable experience designing high-quality dashboards using Power BI
  • Strong database design skills, including an understanding of both normalized form and dimensional form databases
  • In-depth knowledge and experience of data-warehousing strategies and techniques e.g., Kimble Data warehousing
  • Excellent understanding of ETL using numerous technologies
  • Strong database design skills, including an understanding of both normalized form and dimensional form databases.
  • Strong advanced SQL and query optimization skills
  • Strong analytical and problem-solving skills
  • Knowledgeable in software development lifecycles/methodologies, i.e., agile
  • Strong presentation and collaboration skills and can communicate all aspects of the job requirements, including the creation of formal documentation
  • Strong problem solving, time management, and organizational skills
  • Previous experience in a Senior Lead or Team Leader role in an Agile Development environment.
  • Broad BI expertise on a number of different technologies with experience of picking up new skills quickly to keep up with the fast-paced technological advances in BI
  • Demonstrated ability to coach and mentor employees
  • Self-starter who can manage own direction and projects
  • Excellent communication skills
  • Being delivery-focused with a can-do attitude in a sometimes-challenging environment is essential.
  • Experience architecting and delivering applications within cloud/SAAS/multi-tenancy environments is desirable
  • Integration of global applications such as D365, Salesforce, Workday and Concur into cloud data warehouse.
  • 3/5 years’ experience in developing data lakes and data warehouses using Microsoft Azure
  • Experience working with finance data highly desirable

Additional Information

We have created a great place to work by sticking to our core belief that a great company is built around great people and great results.

dentsu’s “eight ways” shape and guide the way we do things here, so that, together, we can achieve the ‘never before’ for our clients, for society, and for each other.

We dream loud.

We inspire change.

We team without limits.

We all lead.

We make it real.

We climb high.

We choose excitement.

We are a force for good.

We are dentsu.

Diversity is embedded in who we are and all that we do: our mindset, our solutions, and our teams to empower an inclusive, equitable environment. We put our people at the center, creating space for growth, understanding, and learning so they can thrive. Our differences make us richer and enable stronger relationships with each other and foster greater impact for our clients. We engage with our communities to drive positive social impact by fostering equity and working to create a digital society that works for all. Dentsu (the "Company") is committed to a policy of Equal Employment Opportunity and will not discriminate against an applicant or employee of the Company, based on age, sex, sexual orientation, race, color, creed, religion, ethnicity, national origin, alienage or citizenship, disability, marital status, veteran or military status, genetic information, or any other legally recognized protected basis under federal, state or local laws, regulations or ordinances. Applicants with disabilities may be entitled to reasonable accommodation under the terms of the Americans with Disabilities Act and/or certain state or local laws. A reasonable accommodation is a change in the way things are normally done that will ensure an equal employment opportunity without imposing an undue hardship on the Company. Please contact [email protected] if you need assistance completing any forms or to otherwise participate in the application process or to request or discuss an accommodation in connection with a job at dentsu.   

This job description is a summary of the essential functions of the job, not an exhaustive or comprehensive list of all possible job responsibilities, tasks, and duties. The responsibilities, tasks, and duties of the jobholder might differ from those outlined in the job description. Other duties, as assigned by the supervisor, might be part of the job. Applicants must be currently authorized to work in the U.S. on a full-time basis. No sponsorship is available for this position.

#LI-JH1

+30d

Technical Lead, Information Security

AltisourceBengaluru, Karnataka, India, Remote
8 years of experienceDesign

Altisource is hiring a Remote Technical Lead, Information Security

Company Description

Altisource Portfolio Solutions S.A. (NASDAQ: ASPS) is an integrated service provider and marketplace for the real estate and mortgage industries. Combining operational excellence with a suite of innovative products and technologies, Altisource helps solve the demands of the ever-changing market. Additional information is available at altisource.com.

Job Description

Essential Functions:

  •  Designs SOC system architectures and controls
  • Understand and review logs from SIEM/DLP
  • Creates SOC system requirements
  • Creates and maintains SOC architecture diagrams
  • Understands advanced Cyber Threats and creates system and network mitigation strategies

 

Knowledge, Skills & Abilities

  • Deep technical analytical & troubleshooting skill and ability to determine appropriate action
  • Thorough understanding of latest security principles, techniques and protocols, patching and security updates
  •  Work with IT architecture, design and engineering peers to align the security architecture
  • Good understanding of SOC concepts and log review from various sources such as SIEM, proxy, AV, DLP etc.
  • Excellent understanding of security concepts related to data loss protection, Antivirus, Proxy
  • Understanding of Network and Firewall
  • Demonstrable experience in embedding security into the change lifecycle

 

Qualifications

 

Required Qualifications

  •  Bachelor’s degree in information systems, computer science, or related field or equivalent relevant experience
  •  5 to 8 years of experience in SOC  and Log monitoring
  • Experience with Qrader SIEM and reporting
  • Sound understanding of Security tools such as SIEM, Proxy, AV & DLP
  • Excellent verbal and written communication skills. Ability to explain technical security concepts to nontechnical colleagues at all levels of the organization
  • Ability to work independently and support multiple stakeholders
  • Relevant SOC certifications preferred

Additional Information

WORKING AT ALTISOURCE ADVANTAGES

Prosperity

  • Competitive salary based on your experience and skills – we believe the top talent deserves the top rupee
  • Bonus Potential – if you go above and beyond, you should be rewarded

Good Health

  • Comprehensive insurance plans like Medical, Personal Accident Benefit and Life Insurance
  • Wellness Programs (examples include eye examination, diabetes checkup camp, hemoglobin check and health talks)

Happiness

  • 10 paid holidays, plus 26 paid days off per year
  • Lots of employee engagement activities both offsite (examples include family cricket/football games, annual company celebrations and happy hours) and onsite (examples include office stress buster events, holiday parties, and quarterly Living our Values celebrations)
  • Opportunities to join our community service initiatives, including Habitat for Humanity

Are you up to the challenge? What are you waiting for? Apply today!

If you have any questions or concerns, feel free to reach out to us at[email protected]

We are an equal opportunity employer and value diversity at our company. We do not discriminate on the basis of race, religion, color, national origin, gender, sexual orientation, age, marital status, veteran status, or disability status.

See more jobs at Altisource

Apply for this job

+30d

Technical Lead, Salesforce B2B Platform (remote), Consumer Services

Experian475 Anton Blvd, Costa Mesa, CA 92626, USA, Remote
agilejiraB2BsalesforceDesignjqueryc++pythonAWSjavascript

Experian is hiring a Remote Technical Lead, Salesforce B2B Platform (remote), Consumer Services

Company Description

We are thrilled to share that FORTUNE has named Experian one of the 100 Best Companies to Work For. In addition, for the last five years we’ve been name in the top 100 “World’s Most Innovative Companies” by Forbes Magazine.

Experian Consumer Services (ECS) – Careers That Define “What’s the Next Big (Data) Thing” for Consumers?

What could be more exciting – personally and professionally – than being part of a “disruptive” business? Consider taking your career to the next level by joining the Leader that continues to disrupt the competition. As the “disruptor” and market leader we pride ourselves on building new markets, leading the pack through continuous evolution and innovation. It’s a position Experian Consumer Services (ECS) has enjoyed for more than a decade and we’re always looking for the talent that can help expand that lead.

Job Description

These days, the “next big thing” is often “the next Big Data thing.” Experian Consumer Services offers an opportunity to lead the charge in turning consumer data into something people use and value every single day. We live in a world where information is a means to improving lives and we challenge our team to do just that: improve lives with our products.

Qualifications

What you’ll be doing

Experian Consumer Services (ECS) is in search of an energetic, team-oriented, broadly skilled Technical Lead to help us deliver our next generation B2B Digital Experience Platform (DXP). You will be responsible for leading a team in the delivery of this new eCommerce platform from the ground up. As Technical Lead you will supervise the day-to-day activity of the development team as well as function as the project's architect and most senior application engineer

You will be involved in all aspects of software delivery from sprint planning, standups, and code reviews to architecture, design, and development. In this role, you will also function as the bridge between the Product Owner and your technical team

This role is more than just a “very senior” engineer and definitely not an order taker. The ideal candidate will be a people leader and a true solution consultant challenging the status quo while providing innovative ways to solve complex business problems.

Additional Information

What your background looks like

Role & Responsibility:

  • Lead design and development activities of our eCommerce portal
  • Responsible for leading the development team in design and development while establishing development practices that align with Agile and DevOps philosophies.
  • Lead the development of integration interfaces between internal systems and external tools for functions such as eCommerce, CRM, CMS, Reporting, CPQ, Single Sign-On, etc.
  • Participate in the delivery of processes and structures to support a secure, high availability, enterprise system: CI/CD delivery pipeline, automated testing, real-time monitoring, and alerting
  • Collaborate with the business to understand their requirements and translate that into a design and architecture that your team can deliver on. And support them in their delivery.
  • Support the Program Manager by identifying, managing, and tracking key project dependencies, issues, and planning for risk avoidance
  • Conduct daily standups, design, and code reviews to ensure the quality of delivery
  • Optimize and improve. We will continually be looking for opportunities to optimize our site performance and scalability
  • This will be a multi-year program and after delivery, you’ll be responsible for leading the team in the ongoing enhancement and support of this system. So, build a strong team and build in resiliency
  • And have fun. Ensure that the culture you create for the team is challenging, rewarding, and enjoyable.

Education and Experience:

  • 5+ years previous CRM development experience on an enterprise CRM/Digital Experience Platform (DXP). (Salesforce/Adobe/Acquia/Optimizely).
  • Bachelor’s degree in relevant field or equivalent experience.
  • 2+ years’ experience designing and developing software/applications using front-end and back-end tools, such as HTML, XML, jQuery, C++, Python, and Java.
  • Experience with back-end or front-end web development and related skills, including SOAP & REST services, object-oriented design, Apex & LWC, JavaScript, etc.
  • Experience with Jira and other Atlassian tools for agile lifecycle management
  • Experience of DevOps and CI/CD, automated test and build tools
  • We are a heavy AWS environment so experience in AWS is a big plus
  • 2 or more platform certifications such as Salesforce Certified Application Architect, Integration Architecture Designer, Sharing and Visibility Designer, System Architect, Service Cloud Consultant or B2B Solution Architect

Perks

  • During this pandemic, all Experian employees are working remotely.
  • Four weeks of vacation to start, five sick days and two volunteer days (plus twelve paid holidays)
  • Competitive pay and comprehensive benefits package, with a bonus target of 20%
  • Flexible work schedule and relaxed dress code

 

Experian is proud to be an Equal Opportunity and Affirmative Action employer. Our goal is to create a thriving, inclusive and diverse team where people love their work and love working together. We believe that diversity, equity and inclusion is essential to our purpose of creating a better tomorrow. We value the uniqueness of every individual and want you to bring your whole, authentic self to work. For us, this is The Power of YOU andand it reflects what we believe.  See our DEI work in action!

If you live in Colorado, Connecticut or New York City, please contact us here for the salary range of this position (include this Job Title in your email). In addition to a competitive base salary and variable pay opportunity, Experian offers a comprehensive benefits package including health, life and disability insurance, generous paid time off including parental and family care leave, an employee stock purchase plan and a 401(k) plan with a company match.

Experian U.S. employees are required to be fully vaccinated for COVID-19.

Experian Careers - Creating a better tomorrow together

Find out what its like to work for Experian by clicking here

See more jobs at Experian

Apply for this job

+30d

Java Technical Lead

agilesqlDesignjavadockerjenkinsAWS

Koombea Inc is hiring a Remote Java Technical Lead

 

Remote, Latam |  Full Time |  7+ years experience |  English (B2) | Competitive Salary

Why Apply to Koombea?

Did you know that Koombea is one of Latin America's fastest-growing software development companies? We help our clients all over the world build digital products that make users' lives better.

By joining our team, you will not only receive amazing benefits and become part of a flexible and innovative work culture. You will also get to share directly with some of the region's most talented and intelligent software developers.

The Job

You'll be in charge of directing the back-end engineering team and managing their senior engineers, as well as collaborating directly with the CTO to design and execute new systems, manage production system operations, and coordinate work across all of the Engineering team's objectives.

He or she will work in a distributed architecture, laying the groundwork for managing Big Data and solving hard algorithmic issues. Will implement revenue-generating and efficiency-improving initiatives in accordance with the company's strategy. Will maintain a thorough understanding of the company's technologies and architectures. Will create and enforce master data management and development best practices. Will serve as the team's focal point.

The ideal applicant is a driven programmer with extensive experience designing and implementing complicated systems. Capable of producing amazing quantities and quality of product.

What You’ll Do

  • Keep   enhancing back-end  systems to improve performance, security, scalability, maintainability, and flexibility.
  • Technically oversee the developments in progress by providing technical guidance.
  • Participate in development life cycle activities like design, coding, testing and production release.
  • Deliver code in an agile team environment.
  • Lead code reviews to drive the team to the highest standards.
  • Drive innovation through rapid prototyping and iterative development.

What You Bring to the Team

  • MS in Computer Science or a related technical field | Must to have
  • 9+ years’ experience in software development | Must to have
  • 7+ years’ experience in Java | Must to have
  • Proven leadership experience | Must to have
  • Extensive experience with Service Oriented Architectures | Must to have
  • Solid experience with SQL | Must to have
  • Extensive experience with unit test frameworks such as JUnit, Mockito, TestNG etc | Must to have
  • Familiarity with AWS | Must to have
  • Familiarity with Docker | Must to have
  • Strong analytical skills | Must to have
  • Ability to work independently and with teams | Must to have
  • Familiarity with automation and continuous integration tools like Jenkins | Nice to have
  • Experience with Test Driven Development techniques | Nice to have
  • Experience working with high-traffic websites is a plus | Nice to have
  • Experience with Machine Learning | Nice to have
  • Familiarity with Hadoop | Nice to have

We Offer You

  • Flexible Working Schedule
  • Health Insurance
  • Remote Work
  • Competitive Compensation
  • Performance Bonuses
  • Surprise Goodies
  • Many Cool Benefits

About Koombea

Koombea is an international app development company founded in 2007. We've built hundreds of apps. Some of them have been acquired by companies like Google, Motorola Solutions, Demandforce, Facebook, and Skype.

Life at Koombea

If you are looking for a fun and international environment where you can interact with super-smart people, this is the right place for you. 

Join our company and enjoy a healthy work-life balance where flexibility is vital. You will be able to manage your schedule and your career so that you make the most out of your experience at Koombea.

Hiring Process

1. Apply

Send us your CV and our team of recruiters will evaluate it.

2. Interviews

Key team members will invite you to meetings to get to know you better.

3. Coding Test

You’ll get to show off your technical skills.

4. Decision

We will let you know if there is a strong fit.

Do you have any questions? 

We’d love to hear from you. 

Feel free to contact us at recruiting@koombea.com

Related Jobs

  1. Senior Full Stack Developer
  2. Tech Lead Developer

Not ready to apply?

Follow us, join our community and stay in the loop.

Position Highlights

  • English B2
  • Remote, Latam
  • 7+ years experience

#Li-remote

See more jobs at Koombea Inc

Apply for this job

+30d

Frontend Technical Lead (Remote, USA)

McFadyen DigitalVienna, VA 22180, USA, Remote
agilemagentoDesignjquerymobileuicssangularjavascriptfrontendNode.js

McFadyen Digital is hiring a Remote Frontend Technical Lead (Remote, USA)

Company Description

McFadyen Digital is the leading advisor and implementer of ecommerce marketplace solutions.  During 15 years of implementing marketplaces, we’ve built dozens of platforms that cumulatively generate billions of dollars of GMV.  We’re honored to have served 10% of the Fortune 500.  Over 250 global brands like ABB, AB InBev, ACCO, Albertsons, American Red Cross, American Eagle Outfitters, US Army, US Agriculture Dept, (and many more letters in the alphabet) have entrusted their digital transformations to McFadyen. We operate global offices across the US, Brazil, and India. McFadyen Digital has been a trusted employer for 34 years and believe that people are the most important part of our company.  We’re proud of our Great Place to Work certification.   

Learn more about us at our website: www.mcfadyen.com   

Job Description

McFadyen Digital is looking for a Frontend Technical Lead to work with our amazing global team, and with strong experience leading multiple website constructions. If you believe you have the right skills and challenges don’t scare you, we want to talk to you. 

Job Description 

  • Devise complex architectural front-end functional elements 

  • Experience building user interface automation frameworks 

  • Design and architect eCommerce and business support systems, including data storage, application data flow, and integration into existing systems 

  • Comfortable managing a multitude of projects in multiple releases 

  •  Provide technical leadership to our team for end-to-end development and implementation of new solutions 

  •  Translate conceptual ideas into engaging visual presentations and design solutions 

  •  Provide subject matter expertise to support needs for the business 

  •  Create code standards and ensure consistency 

  •  Proven ability to excel within a fast-paced development team 

  •  Create reusable and clean UI pattern framework that Application Developers can use to plug and play 

  •  Team with our Application Developers to bridge the client side with server side code 

  •  Provide production support for all implemented changes 

  •  Liaise closely with onsite counterparts in order to continue to drive the product forward 

  • Handle customer expectations on challenging projects 

  • Strong commitment to stability, performance, & outstanding user experience 

Qualifications

  • At least 8+ years of experience in UI development and integration for web and mobile applications 

  • Applied experience of UI development principles 

  • Understand the complexities of Rich Internet Applications and device optimal solutions 

  • Strong HTML, JavaScript and CSS experience 

  • Strong React and Node.js experience 

  • Expert in interaction development 

  • Experience in creating responsive web applications 

  • High level understating of frameworks like jQuery, Backbone, Handlebars, and Angular 

  • Conceptual and implementation knowledge of MVC framework 

  • Knowledge and integration experience with server side communication using Ajax and JSON 

  • Experience developing sophisticated front-end applications and solving Cross-browser, Cross-platform, cross-mobile UI issues 

  • Understand implement SEO and Accessibility compliances to the developed applications 

  • Content Management Systems and Mobile interface experience is a plus 

  • Good exposure on eCommerce is preferred and strong experience in agile methodology is a plus 

  • Excellent written and oral communication and interpersonal skills 

  • Passion for web visitor conversions  

Benefits

  • Competitive salary.
  • Medical and Life Insurance.
  • Short and Long Term Disability.
  • Generous 401K plan after three months of employment.
  • Paid Time Off and Sick Leave.
  • Flexible work schedule.

Additional Information

Our Core Values:Client Focus, Owning the outcome, Adaptability and Collaboration. 

 

Keywords:frontend, React, Node.js, JavaScript, UI developer, Technical Lead, Frontend Tech Lead, Marketplace, ecommerce, Magento, commercetools, remote, Mirakl. 

See more jobs at McFadyen Digital

Apply for this job

+30d

Frontend Technical Lead (Remote, Brazil)

McFadyen DigitalFlorianópolis, State of Santa Catarina, Brazil, Remote
agilemagentoDesignjquerymobileuicssangularjavascriptfrontendNode.js

McFadyen Digital is hiring a Remote Frontend Technical Lead (Remote, Brazil)

Company Description

McFadyen Digital is the leading advisor and implementer of ecommerce marketplace solutions.  During 15 years of implementing marketplaces, we’ve built dozens of platforms that cumulatively generate billions of dollars of GMV.  We’re honored to have served 10% of the Fortune 500.  Over 250 global brands like ABB, AB InBev, ACCO, Albertsons, American Red Cross, American Eagle Outfitters, US Army, US Agriculture Dept, (and many more letters in the alphabet) have entrusted their digital transformations to McFadyen. We operate global offices across the US, Brazil, and India. McFadyen Digital has been a trusted employer for 34 years and believe that people are the most important part of our company.  We’re proud of our Great Place to Work certification.   

Learn more about us at our website: www.mcfadyen.com   

Job Description

McFadyen Digital is looking for a Frontend Technical Lead to work with our amazing global team, and with strong experience leading multiple website constructions. If you believe you have the right skills and challenges don’t scare you, we want to talk to you. 

Job Description 

  • Devise complex architectural front-end functional elements 

  • Experience building user interface automation frameworks 

  • Design and architect eCommerce and business support systems, including data storage, application data flow, and integration into existing systems 

  • Comfortable managing a multitude of projects in multiple releases 

  •  Provide technical leadership to our team for end-to-end development and implementation of new solutions 

  •  Translate conceptual ideas into engaging visual presentations and design solutions 

  •  Provide subject matter expertise to support needs for the business 

  •  Create code standards and ensure consistency 

  •  Proven ability to excel within a fast-paced development team 

  •  Create reusable and clean UI pattern framework that Application Developers can use to plug and play 

  •  Team with our Application Developers to bridge the client side with server side code 

  •  Provide production support for all implemented changes 

  •  Liaise closely with onsite counterparts in order to continue to drive the product forward 

  • Handle customer expectations on challenging projects 

  • Strong commitment to stability, performance, & outstanding user experience 

Qualifications

  • At least 8+ years of experience in UI development and integration for web and mobile applications 

  • Applied experience of UI development principles 

  • Understand the complexities of Rich Internet Applications and device optimal solutions 

  • Strong HTML, JavaScript and CSS experience 

  • Strong React and Node.js experience 

  • Expert in interaction development 

  • Experience in creating responsive web applications 

  • High level understating of frameworks like jQuery, Backbone, Handlebars, and Angular 

  • Conceptual and implementation knowledge of MVC framework 

  • Knowledge and integration experience with server side communication using Ajax and JSON 

  • Experience developing sophisticated front-end applications and solving Cross-browser, Cross-platform, cross-mobile UI issues 

  • Understand implement SEO and Accessibility compliances to the developed applications 

  • Content Management Systems and Mobile interface experience is a plus 

  • Good exposure on eCommerce is preferred and strong experience in agile methodology is a plus 

  • Excellent written and oral communication and interpersonal skills 

  • Passion for web visitor conversions  

Additional Information

Our Core Values:Client Focus, Owning the outcome, Adaptability and Collaboration. 

 

Keywords:frontend, React, Node.js, JavaScript, UI developer, Technical Lead, Frontend Tech Lead, Marketplace, ecommerce, Magento, commercetools, remote, Mirakl. 

 

McFadyen Solutions is an Equal Opportunity Employer. All qualified applicants will receive consideration for employment without regard to race, color, age, religion, sex, sexual orientation, gender identity / expression, national origin, disability, protected veteran status, or any other characteristic protected under federal, state or local law, where applicable.

See more jobs at McFadyen Digital

Apply for this job

+30d

Technical Lead - React| Node

Architech180 John St, Toronto, ON M5T 1X5, Canada, Remote
agileDesignansiblemongodbazuregraphqljavadockerelasticsearchmysqltypescriptkuberneteslinuxjenkinsAWSjavascriptNode.js

Architech is hiring a Remote Technical Lead - React| Node

Company Description

Architech is a Toronto-based software company with over 16 years of experience in creating technology solutions for clients across North America. We leverage the latest cloud technology and hire top talent to modernize applications so that businesses can succeed in today’s digital world. 

Our Dream Team has a main hub in Toronto, but expands across Canada and Kraków, Poland. Our team consists of over 100 certified technical experts in our Product, Design, Engineering, and Delivery disciplines. Our values drive our culture of success: Think Big, Be Open & Collaborate, Never Fail a Client, Grow Our People, Do the Right Thing, and Embrace Change. 

Be Open & Collaborate: Our Culture Says It All

You’ll work very closely with a diverse tight-knit group of creative and talented people who are passionate about technology, software, and solutions. Not only will you work in a collaborative and supportive environment, you’ll also grow your existing skills while keeping up with technology trends.

Who We Are

We’re passionate about creating an environment where every team member feels empowered to share their unique point of view. We celebrate diverse talents and encourage our teammates to share their whole selves – because our greatest source of inspiration is each other, and we believe diversity drives innovation. 

In order to be inclusive, we must be intentional. We have taken a multi-pillar approach to D&I at Architech including: Listening & Learning, Being an Ally, and Accountability.

In 2020 we launched our first Diversity & Inclusion survey. While we are always striving for more equal representation, we are very proud of our results:

  • 31% women, 57% BIPOC, 14% LGBTQIA+
  • 49% of our people were born in countries other than where our offices are located. Our team members collectively speak 19 different languages. 59% of our people speak more than one language
  • In the past year Architech has increased the number of women in our technology function by 200%. We strive to do even better as our multi-year strategic plan unfolds.
  • We analyzed salaries by gender of persons in the same role and are delighted to report a 0% gender pay gap in our delivery and technology roles!

What Our People Say

“Employees of different backgrounds interact well within our company” – 97% of employees agree

 “Architech respects individuals and values their differences” - 96% of employees agree

We Grow When You Grow

We encourage and support continuous learning by ensuring everyone stays active in the tech community. To help you with this, we offer tools and programs such as Learning Budget, Certification Bonuses, Internal Bootcamps, Summit Days, Lunch & Learns and much more. And this is just the beginning. Check out all our other great benefits. 

Welcome to Architech. 

Job Description

  • Build scalable, reliable, secure systems using open-source technologies that align with Architech’s Technology Strategy. 
  • Combine Java, Spring Boot, Node.js, AngularJS, React.js as required and appropriate for each project. 
  • Leverage data, caching and search solutions such as MongoDB, MySQL, Kafka, Redis, Memcached, Elasticsearch, Solr to build performant, data-rich solutions. 
  • Secure access to solutions leveraging standards such as OAuth2 and OpenID Connect. 
  • Play a pivotal role in the mentorship, guidance, and performance of the Engineers who report directly to you. 
  • Leader by example for the quality of code created by your team members to ensure optimal balance of code quality metrics such as coupling, cohesion, testability. 
  • Lead Agile Engineering teams with Designers and Strategists to continuously iterate, validate and build feedback into the solution. 
  • Collaborate closely with the team Project Manager as the subject matter expert in client meetings and demos. 
  • Contribute to the design and implementation of solution archetypes that are composed into complex, cloud native solution architectures. 
  • Contribute to the continuous evolution of Architech’s open-source, cloud-first technology strategy. 
  • Work with our partner technologies within projects including Azure, DotCMS and Red Hat. 
  • Embrace and contribute to the achievement of Architech’s sustainability goals relating to Good Health & Well-being, Quality Education, Gender Equity and Reduced Inequalities

Qualifications

  • 5+ years experience in front-end web development. 
  • Strong hands on experience with React including JavaScript, Typescript and CSS. 
  • Extensive experience working with Node.js - Express.js 
  • Proven experience leading a team of engineers in multiple projects, including mentoring junior engineers and guiding their professional growth. 
  • Extensive and excellent client-facing skills. 
  • Must be a problem solver who gets excited about challenging engineering puzzles. 
  • Astute and passionate about engineering digital solutions that solves real business problems. 
  • Should willing to learn and absorb the rapid changes in the software engineering industry. 
  • Should be willing to approach all projects with ruthless focus on the end-user and customer. 
  • Must be a team player, and this will be demonstrated through setting team members up for success. 

Nice to Have:

  • Post-secondary degree or diploma in Computer Science or related program.
  • Experience working with GraphQL and Angular. 
  • Knowledge of technologies such as Kubernetes, Docker, Ansible, Jenkins, Sonarqube, Linux, Azure and AWS services. 

Additional Information

Competitive Salary 
2% RRSP Matching from Day 1
Health Insurance from Day 1
Gym Membership Discount from Day 1
Learning Budget
Certification Bonuses
3 weeks paid vacation and 2 balance days
Health and Wellness Allowance
Paid Maternity and Paternity Leave
Social events and volunteer programs
Lunch and Learn Events

Architech is an equal opportunity employer committed to diversity. Should you require any accommodations prior to or during the interview process, please indicate this during the interview process. We strongly encourage applications from racialized people, people with disabilities, people from gender and sexually diverse communities and/or people with intersectional identities.

See more jobs at Architech

Apply for this job