typescript Remote Jobs

372 Results

9d

Senior Frontend Developer

Shiji GroupKatowice, Poland, Remote
Designhtml5UXdockertypescriptjavascript

Shiji Group is hiring a Remote Senior Frontend Developer

Job Description

 

Your job will be to develop a part of a distributed system that serves the hospitality industry. It is a solution that allows hotel employees or hotel managers to handle various activities such as managing reservations, payments and hotel services within the hotel or between hotels. The system consists of many domain-oriented microservices developed under a few cross-functional teams.

 

Technologies we use:

 

  • React ecosystem
  • SCSS
  • Web Components, Stencil
  • Jest, Testing Library, Enzyme, QUnit
  • Webpack, Babel
  • TypeScript
  • Gitlab
  • Docker and Docker Compose
  • Design patterns and clean code practices (OOP, SOLID)

 

Key Areas of Responsibility:

 

  • Deliver highly customizable features and widgets
  • Developing and maintaining software features based on visual mockups and UX descriptions
  • Writing tests
  • Delivering high-quality code, which is both functional and performant
  • SOLID understanding of best practices, processes and design patterns in software development
  • Contributing to the infrastructure that the team leverages for development
  • Code reviewing

 

Qualifications

  • Minimum 5 years’ experience as JavaScript or Front-End Developer
  • Advanced understanding of JavaScript ES6/TypeScript
  • General awareness of web application performance best practices
  • Experience in work with or contribute to a JavaScript based build system (e.g., Babel, Webpack)
  • Experience with React, React Hooks
  • Having experience with further Front-End technologies is nice to have but not necessary
  • Interest in testing, review and code quality
  • Good knowledge of: HTML5, CSS3, SCSS, Jest/Enzyme, Web Components

See more jobs at Shiji Group

Apply for this job

9d

Frontend Developer

Shiji GroupKatowice, Poland, Remote
Designhtml5scrumUXgitdockertypescriptlinuxjavascript

Shiji Group is hiring a Remote Frontend Developer

Job Description

Your job will be to develop a part of a distributed system that serves the hospitality industry. It is a solution that allows hotel employees or hotel managers to handle various activities such as managing reservations, payments and hotel services within the hotel or between hotels. The system consists of many domain-oriented microservices developed under a few cross-functional teams.

 

Key Areas of Responsibility:

 

  • Deliver highly customizable features and widgets
  • Getting requirements about functionalities, developing and maintaining software features based on visual mockups and UX descriptions in scrum manner (sprints, grooming, planning, retrospective sesssions)
  • Working with the newest technologies, best practices and patterns in software development
  • Delivering high-quality code, which is both functional and performant
  • Writing tests
  • Code reviewing
  • Contributing to the infrastructure that the team leverages for development
  • Contributing in design of solutions with team members
  • Sharing knowledge with other developers
  • Working with microfrontends and microservices in multi-region environment

 

Our Daily Work

 

  • we work in iterations with refinements, plannings and retrospective meetings
  • we use Gitlab to sync the code with develop and master branches, and create feature branch for each User Story
  • we commit daily and use CI/CD using Gitlab
  • we open merge requests and wait for review for other team members before merge
  • we use docker and docker compose for local development and deployment of all microservices
  • we use Teams to communicate and or participate in meetings with other team members
  • we cooperate with UI/UX department to provide user the best possible looks and feel of application
  • we create NPM internal packages to share work with others, create design systems and avoid repetitions

 

Technologies we use:

 

  • React ecosystem
  • SCSS
  • Web Components, Stencil
  • Jest, Testing Library, Enzyme, QUnit
  • Webpack, Babel
  • TypeScript
  • Gitlab
  • Docker and Docker Compose
  • Design patterns and clean code practices (OOP, SOLID)
  • Ember

 

Qualifications

  • Minimum 4 years’ experience as JavaScript or Front-End Developer
  • Advanced understanding of JavaScript ES6/TypeScript
  • Good knowledge of HTML5, CSS3
  • Experience in work with or contribute to a JavaScript based build system (e.g., Babel, Webpack)
  • Experience with React ecosystem (React hooks)
  • Interest in testing, review and code quality
  • Familiar with Git
  • SOLID understanding of best practices, processes and design patterns
  • Open mind, contribution in discussions and good communication, especially inside of the team
  • Participation in designing solutions
  • Readiness to share knowledge and help team members
  • Self-reliance in daily work but also willingness for asking for help
  • Good English, both written and spoken

 

Nice to have but it is not a must:

 

  • Basics of linux, docker
  • Experience with form libraries
  • Knowledge of Functional Programming and Object Oriented Programming

See more jobs at Shiji Group

Apply for this job

11d

Software Engineer II, Full Stack - Safety Event Triage

SamsaraRemote - US
Bachelor's degreeDesignvuemobileazuregraphqlapijavatypescriptpythonAWS

Samsara is hiring a Remote Software Engineer II, Full Stack - Safety Event Triage

Who we are

Samsara (NYSE: IOT) is the pioneer of the Connected Operations™ Cloud, which is a platform that enables organizations that depend on physical operations to harness Internet of Things (IoT) data to develop actionable insights and improve their operations. At Samsara, we are helping improve the safety, efficiency and sustainability of the physical operations that power our global economy. Representing more than 40% of global GDP, these industries are the infrastructure of our planet, including agriculture, construction, field services, transportation, and manufacturing — and we are excited to help digitally transform their operations at scale.

Working at Samsara means you’ll help define the future of physical operations and be on a team that’s shaping an exciting array of product solutions, including Video-Based Safety, Vehicle Telematics, Apps and Driver Workflows, Equipment Monitoring, and Site Visibility. As part of a recently public company, you’ll have the autonomy and support to make an impact as we build for the long term. 

Recent awards we’ve won include:

Glassdoor's Best Places to Work 2024

Best Places to Work by Built In 2024

Great Place To Work Certified™ 2023

Fast Company's Best Workplaces for Innovators 2023

Financial Times The Americas’ Fastest Growing Companies 2023

We see a profound opportunity for data to improve the safety, efficiency, and sustainability of operations, and hope you consider joining us on this exciting journey. 

Click hereto learn more about Samsara's cultural philosophy.

About the role:

The Safety Event Triage team owns systems and customer-facing interfaces across web, mobile, and API surfaces designed to identify unsafe driving behaviors and facilitate quick remediation through coaching and training. Our mission is to ensure customer fleet safety. We do this by closely collaborating with other Safety teams, including ML & AI engineering, to ingest sensor and media based data, detect risky behaviors, and implement workflows to score, report, and coach fleet drivers. As a full-stack Software Engineer on this team, you will work closely with Design and Product to enhance and expand our products, refine triage workflows based on customer input, and improve overall fleet safety for our diverse customer base.

You should apply if:

  • You want to impact the industries that run our world: The software, firmware, and hardware you build will result in real-world impact—helping to keep the lights on, get food into grocery stores, and most importantly, ensure workers return home safely.
  • You want to build for scale: With over 2.3 million IoT devices deployed to our global customers, you will work on a range of new and mature technologies driving scalable innovation for customers across industries driving the world's physical operations.
  • You are a life-long learner: We have ambitious goals. Every Samsarian has a growth mindset as we work with a wide range of technologies, challenges, and customers that push us to learn on the go.
  • You believe customers are more than a number:Samsara engineers enjoy a rare closeness to the end user and you will have the opportunity to participate in customer interviews, collaborate with customer success and product managers, and use metrics to ensure our work is translating into better customer outcomes.
  • You are a team player: Working on our Samsara Engineering teams requires a mix of independent effort and collaboration. Motivated by our mission, we’re all racing toward our connected operations vision, and we intend to win—together.

Click hereto learn more about Samsara's cultural philosophy.  

In this role, you will: 

  • Solve complex problems as you architect, build, test, and deliver full-stack products.
  • Collaborate with engineers, product managers, designers, and support teams to deliver customer-facing solutions.
  • Build upon skills and knowledge across a range of technologies such as Golang, GraphQL, Typescript, React, and MySQL. Previous experience with these technologies is not required.
  • Own the operational health of production systems as we build for the future scale of an ever-growing customer base.
  • Champion, role model, and embed Samsara’s cultural principles (Focus on Customer Success, Build for the Long Term, Adopt a Growth Mindset, Be Inclusive, Win as a Team) as we scale globally and across new offices.

Minimum requirements for the role:

  • 2+ years of professional software development experience.
  • Strong programming/coding fundamentals in a language such as Java, Python, or Golang.
  • Knowledge of designing, architecting, developing, and monitoring full-stack applications at scale.
  • Experience using data to investigate issues and make the right call to resolve them.
  • An ability to estimate, communicate, and deliver on project milestones with your team.
  • A growth mindset and excitement around building new skills and expertise.

An ideal candidate also has:

  • Experience with web application development using modern frameworks such as React, Vue, Svelte.
  • Knowledge of cloud computing platforms, such as AWS, Azure, or Google Cloud.
  • Experience in designing, developing, and managing cloud-based infrastructure and applications.
  • Bachelor's degree in Computer Science, Engineering, or a related field.

Samsara’s Compensation Philosophy:Samsara’s compensation program is designed to deliver Total Direct Compensation (based on role, level, and geography) that is at or above market. We do this through our base salary + bonus/variable + restricted stock unit awards (RSUs) for eligible roles.  For eligible roles, a new hire RSU award may be awarded at the time of hire, and additional RSU refresh grants may be awarded annually. 

We pay for performance, and top performers in eligible roles may receive above-market equity refresh awards which allow employees to achieve higher market positioning.

The range of annual base salary for full-time employees for this position is below. Please note that base pay offered may vary depending on factors including your city of residence, job-related knowledge, skills, and experience.
$102,638$172,500 USD

At Samsara, we welcome everyone regardless of their background. All qualified applicants will receive consideration for employment without regard to race, color, religion, national origin, sex, gender, gender identity, sexual orientation, protected veteran status, disability, age, and other characteristics protected by law. We depend on the unique approaches of our team members to help us solve complex problems. We are committed to increasing diversity across our team and ensuring that Samsara is a place where people from all backgrounds can make an impact.

Benefits

Full time employees receive a competitive total compensation package along with employee-led remote and flexible working, health benefits, Samsara for Good charity fund, and much, much more. Take a look at our Benefits site to learn more.

Accommodations 

Samsara is an inclusive work environment, and we are committed to ensuring equal opportunity in employment for qualified persons with disabilities. Please email accessibleinterviewing@samsara.com or click hereif you require any reasonable accommodations throughout the recruiting process.

Flexible Working 

At Samsara, we embrace a flexible working model that caters to the diverse needs of our teams. Our offices are open for those who prefer to work in-person and we also support remote work where it aligns with our operational requirements. For certain positions, being close to one of our offices or within a specific geographic area is important to facilitate collaboration, access to resources, or alignment with our service regions. In these cases, the job description will clearly indicate any working location requirements. Our goal is to ensure that all members of our team can contribute effectively, whether they are working on-site, in a hybrid model, or fully remotely. All offers of employment are contingent upon an individual’s ability to secure and maintain the legal right to work at the company and in the specified work location, if applicable.

Fraudulent Employment Offers

Samsara is aware of scams involving fake job interviews and offers. Please know we do not charge fees to applicants at any stage of the hiring process. Official communication about your application will only come from emails ending in ‘@samsara.com’ or ‘@us-greenhouse-mail.io’. For more information regarding fraudulent employment offers, please visit our blog post here.

Apply for this job

11d

Senior/Principal Python Developer (AdTech)

Sigma SoftwareKyiv, Ukraine, Remote
sqlapitypescriptpythonAWSjavascript

Sigma Software is hiring a Remote Senior/Principal Python Developer (AdTech)

Job Description

  • Writing clean, efficient, and maintainable code in Python 
  • Implementing APIs and integrating external systems 
  • Designing, optimizing, and managing SQL database modules 
  • Performance improvement and code optimization 
  • Covering code with unit tests 

Qualifications

  • 6+ years of experience with Python
  • 2+ years of experience with FAST API 
  • Good knowledge of JavaScript (TypeScript, React) 
  • Experience with AWS 
  • Ability to work independently 
  • At least an Upper-Intermediate level of English 
  • Focus on simplicity and quality 
  • Excellent problem-solving skills 
  • Good communication skills 

WOULD BE A PLUS:

  • Experience in the AdTech domain 
  • Experience with Facebook Ads/Zemanta/Taboola 

See more jobs at Sigma Software

Apply for this job

11d

QA Analyst (LATAM or Africa)

4 years of experienceagileBachelor's degreekotlinjiraswiftmobileslackiosqajavaandroidtypescriptjavascript

Rapptr Labs is hiring a Remote QA Analyst (LATAM or Africa)

QA Analyst (LATAM or Africa) - Rapptr Labs - Career Page

See more jobs at Rapptr Labs

Apply for this job

11d

EyeControl | Fullstack Web Developer

SD SolutionsWarsaw, PL Remote
mongodbsassdockermysqltypescriptlinuxAWSjavascriptreduxNode.js

SD Solutions is hiring a Remote EyeControl | Fullstack Web Developer

On behalf of EyeControl, SD Solutions is looking for a talented Full-stack Web Developerto join the technical department.

SD Solutions is a staffing company operating globally. Contact us to get more details about the benefits we offer.

Responsibilities:

  • As a full-stack web developer, you will develop, debug, deliver, and maintain a highly-complex system, that is the core of our company's growth.
  • Using the latest software stacks and cloud technologies, you will work on our entire technological stack, from client to server side.
  • We expect you to drive improvements to code quality, web client performance and team processes.
  • Ability to work IL time.

Requirements:

  • 5+ years of relevant experience (focusing on backend development)
  • Experience with HTML, JavaScript, TypeScript, SASS, and modern JavaScript frameworks like React (including state management with Redux or similar).
  • Proficiency in Node.JS (NestJS) and working with databases (MongoDB, DynamoDB, or MySQL).
  • Hands-on experience with AWS cloud services, including IoT, Lambdas, SAM, CloudFormation, and SQS.
  • Knowledge of Docker containerization.
  • Familiarity with CI/CD practices.
  • Experience with Linux environments.
  • Familiarity with Bitbucket and CodePipeline.
  • Excellent written and verbal English communication skills.
  • BSc/MSc in Computer Science (or equivalent).
  • Excellent team player with the ability to work effectively both independently and collaboratively.
  • Strong self-learning capabilities to adapt to new technologies independently.
  • Highly motivated and wants to make a meaningful impact.

Advantages:

  • The abilitytowork Sunday-Thursday will be a plus.

About the company:

EyeControl has developed an eye-tracking wearable and smart platform that empowers communication between patients who cannot speak, their families, and medical teams.

By applying for this position, you agree to the terms outlined in our Privacy Policy. Please take a moment to review our Privacy Policy https://sd-solutions.breezy.hr/privacy-notice, and make sure you understand its contents. If you have any questions or concerns regarding our Privacy Policy, please feel free to contact us.

See more jobs at SD Solutions

Apply for this job

12d

Développeur / Développeuse Frontend React - niveau intermédiaire

XplorLille, France, Remote
agilejiraqatypescriptjenkinsjavascriptbackendfrontend

Xplor is hiring a Remote Développeur / Développeuse Frontend React - niveau intermédiaire

Description du poste

Tu rejoindras Xplor en tant que Développeur / Développeuse Frontend React à Villeneuve d'Ascq au sein de l’équipe Engineering, afin de participer à l’évolution du produit Xplor Resamania dont le développement a démarré en 2016.

Xplor Resamania est notre logiciel de gestion d'entreprise tout-en-un pour les clubs de fitness et de remise en forme. Intuitif et flexible, il intègre le paiement, le contrôle d'accès, la gestion des membres, la vente, la gestion des abonnements, le planning, l'automatisation du marketing, le reporting,...

Rattaché(e) au lead développeur tes missions principales seront de :

  • Développer sur un produit "multi-projets", en collaboration avec les autres équipes (backend, QA, produit ...)
  • Participer aux phases de conception des features
  • Participer activement aux ateliers techniques, aux codes reviews, ...
  • Participer au maintien et à l'évolution de la stack technique
  • Réaliser des tests automatisés
  • Garantir la maintenance évolutive durant les phases de Run
  • Participer aux ateliers méthodologiques et être force de proposition.

Environnement technique : 

  • React 17 (hooks, functional components, ...)
  • Gestion d'état standard (state React + context) + utilisation d'un hook inspiré de TanStack Query
  • 50% de code Javascript, 50% de code Typescript 4.7
  • MUI4 et MUI5
  • Méthodologie Agile (Features teams)
  • Couverture CI (Travis), linters, déploiement avec Jenkins
  • Jira, Github, MS365 …

Qualifications

De formation bac + 2 minimum, tu disposes d’un diplôme dans le secteur de l’informatique. Tu es organisé(e), autonome, tu aimes travailler en équipe et tu disposes d’une forte capacité d’analyse. Ta curiosité te pousse à comprendre comment fonctionne un logiciel : nous cherchons autant des compétences techniques que d’une appétence pour le métier et les aspects fonctionnels de l’application.

Qu'est-ce qui ferait de moi un bon candidat ou une bonne candidate ?

  • une expérience similaire de 2 à 4 ans
  • une forte autonomie dans le travail personnel
  • une bonne capacité à travailler en équipe autant en remote qu’en présentiel (tu travailleras avec plusieurs Devs Back)
  • une bonne capacité à réfléchir à une problématique abstraite et en déduire la réponse la plus pertinente
  • une première expérience sur l'utilisation de MUI, TanStack Query, ou une capacité à apprendre rapidement

See more jobs at Xplor

Apply for this job

12d

Développeur / Développeuse Frontend React - niveau sénior

XplorVilleneuve-d'Ascq, France, Remote
agilejiraqatypescriptjenkinsjavascriptbackendfrontend

Xplor is hiring a Remote Développeur / Développeuse Frontend React - niveau sénior

Description du poste

Tu rejoindras Xplor en tant que Développeur / Développeuse sénior Frontend React à Villeneuve d'Ascq au sein de l’équipe Engineering, afin de participer à l’évolution du produit Xplor Resamania dont le développement a démarré en 2016.

Xplor Resamania est notre logiciel de gestion d'entreprise tout-en-un pour les clubs de fitness et de remise en forme. Intuitif et flexible, il intègre le paiement, le contrôle d'accès, la gestion des membres, la vente, la gestion des abonnements, le planning, l'automatisation du marketing, le reporting,...

Rattaché(e) au lead développeur tes missions principales seront de :

  • Développer sur un produit "multi-projets", en collaboration avec les autres équipes (backend, QA, produit ...)
  • Participer aux phases de conception des features
  • Participer activement aux ateliers techniques, aux codes reviews, ...
  • Participer au maintien et à l'évolution de la stack technique
  • Réaliser des tests automatisés
  • Garantir la maintenance évolutive durant les phases de Run
  • Participer aux ateliers méthodologiques et être force de proposition.

Environnement technique : 

  • React 17 (hooks, functional components, ...)
  • Gestion d'état standard (state React + context) + utilisation d'un hook inspiré de TanStack Query
  • 50% de code Javascript, 50% de code Typescript 4.7
  • MUI4 et MUI5
  • Méthodologie Agile (Features teams)
  • Couverture CI (Travis), linters, déploiement avec Jenkins
  • Jira, Github, MS365 …

Qualifications

De formation bac + 2 minimum, tu disposes d’un diplôme dans le secteur de l’informatique. Tu es organisé(e), autonome, tu aimes travailler en équipe et tu disposes d’une forte capacité d’analyse. Ta curiosité te pousse à comprendre comment fonctionne un logiciel : nous cherchons autant des compétences techniques que d’une appétence pour le métier et les aspects fonctionnels de l’application.

Qu'est-ce qui ferait de moi un bon candidat ou une bonne candidate ?

  • une expérience similaire de 5 à 6 ans
  • une forte autonomie dans le travail personnel
  • une bonne capacité à travailler en équipe autant en remote qu’en présentiel (tu travailleras avec plusieurs Devs Back)
  • une bonne capacité à réfléchir à une problématique abstraite et en déduire la réponse la plus pertinente
  • une solide expérience sur l'utilisation de MUI, TanStack Query, ou une capacité à apprendre rapidement

See more jobs at Xplor

Apply for this job

12d

Software Engineer II, Full-stack - Web Platform

SamsaraCanada - Remote
Bachelor's degreeDesigngraphqlgittypescriptjavascriptfrontend

Samsara is hiring a Remote Software Engineer II, Full-stack - Web Platform

Who we are

Samsara (NYSE: IOT) is the pioneer of the Connected Operations™ Cloud, which is a platform that enables organizations that depend on physical operations to harness Internet of Things (IoT) data to develop actionable insights and improve their operations. At Samsara, we are helping improve the safety, efficiency and sustainability of the physical operations that power our global economy. Representing more than 40% of global GDP, these industries are the infrastructure of our planet, including agriculture, construction, field services, transportation, and manufacturing — and we are excited to help digitally transform their operations at scale.

Working at Samsara means you’ll help define the future of physical operations and be on a team that’s shaping an exciting array of product solutions, including Video-Based Safety, Vehicle Telematics, Apps and Driver Workflows, Equipment Monitoring, and Site Visibility. As part of a recently public company, you’ll have the autonomy and support to make an impact as we build for the long term. 

Recent awards we’ve won include:

Glassdoor's Best Places to Work 2024

Best Places to Work by Built In 2024

Great Place To Work Certified™ 2023

Fast Company's Best Workplaces for Innovators 2023

Financial Times The Americas’ Fastest Growing Companies 2023

We see a profound opportunity for data to improve the safety, efficiency, and sustainability of operations, and hope you consider joining us on this exciting journey. 

Click hereto learn more about Samsara's cultural philosophy.

About the role:

Samsara is hiring a full-stack developer for the Web Platform team. The charter of the team is to accelerate feature development within Samsara’s web product by maintaining a high-quality frontend developer experience, owning common frameworks, shepherding/up-leveling our Design System, ensuring overall frontend health, and building a small set of features that cross-team boundaries.

Our team is currently staffed with several senior engineers along with one staff engineer. There are plenty of experienced folks to learn from. We’re looking for an experienced full-stack engineer who has a strong interest in front-end development to come join us!

You should apply if:

  • You want to impact the industries that run our world: The software, firmware, and hardware you build will result in real-world impact—helping to keep the lights on, get food into grocery stores, and most importantly, ensure workers return home safely.
  • You want to build for scale: With over 2.3 million IoT devices deployed to our global customers, you will work on a range of new and mature technologies driving scalable innovation for customers across industries driving the world's physical operations.
  • You are a life-long learner: We have ambitious goals. Every Samsarian has a growth mindset as we work with a wide range of technologies, challenges, and customers that push us to learn on the go.
  • You believe customers are more than a number:Samsara engineers enjoy a rare closeness to the end user and you will have the opportunity to participate in customer interviews, collaborate with customer success and product managers, and use metrics to ensure our work is translating into better customer outcomes.
  • You are a team player: Working on our Samsara Engineering teams requires a mix of independent effort and collaboration. Motivated by our mission, we’re all racing toward our connected operations vision, and we intend to win—together.

Click hereto learn about what we value at Samsara. 

In this role, you will: 

  • Solve complex problems and own the success of your solutions as you architect, build, test, and deliver full-stack products
  • Communicate, collaborate, and develop with engineers, other platform teams, product teams, product managers, designers, and support teams
  • Build upon skills and knowledge across a range of technologies such as Go, GraphQL, Typescript, React, and MySQL. Due to the nature of the role, previous experience with React is required, but experience with the other technologies is not required
  • Own the operational health of production systems as we build for the future scale of an ever-growing customer base
  • Make an impact on our core architecture, roadmap, and the wider engineering community
  • Champion, role model, and embed Samsara’s cultural principles (Focus on Customer Success, Build for the Long Term, Adopt a Growth Mindset, Be Inclusive, Win as a Team) as we scale globally and across new offices

Minimum requirements for the role:

  • You have at least a Bachelor's degree in Computer Science or similar, or corresponding level of relevant education
  • You have 2+ years of experience working professionally with modern development practices
  • You have knowledge of designing, architecting, and developing applications using modern JavaScript technologies like React and Typescript
  • Experience working with Designers, PMs, and other developers to ship E2E features to production environments
  • At this time we are only looking for candidates in Canada

An ideal candidate also has:

  • Experience building and maintaining a performant and responsive design system
  • Understanding and interest for building and maintaining large applications as well as extensible libraries/frameworks/APIs
  • Strong familiarity of web accessibility
  • Experience with packaging systems (Webpack, Rollup, etc.), frontend testing frameworks (Jest, Enzyme, etc.), linting tools (ESLint, Prettier, etc.), Git, and Storybook

Samsara’s Compensation Philosophy:Samsara’s compensation program is designed to deliver Total Direct Compensation (based on role, level, and geography) that is at or above market. We do this through our base salary + bonus/variable + restricted stock unit awards (RSUs) for eligible roles.  For eligible roles, a new hire RSU award may be awarded at the time of hire, and additional RSU refresh grants may be awarded annually. 

We pay for performance, and top performers in eligible roles may receive above-market equity refresh awards which allow employees to achieve higher market positioning.

The range of annual base salary for full-time employees for this position is below. Please note that base pay offered may vary depending on factors including your city of residence, job-related knowledge, skills, and experience.
$99,875$129,250 CAD

At Samsara, we welcome everyone regardless of their background. All qualified applicants will receive consideration for employment without regard to race, color, religion, national origin, sex, gender, gender identity, sexual orientation, protected veteran status, disability, age, and other characteristics protected by law. We depend on the unique approaches of our team members to help us solve complex problems. We are committed to increasing diversity across our team and ensuring that Samsara is a place where people from all backgrounds can make an impact.

Benefits

Full time employees receive a competitive total compensation package along with employee-led remote and flexible working, health benefits, Samsara for Good charity fund, and much, much more. Take a look at our Benefits site to learn more.

Accommodations 

Samsara is an inclusive work environment, and we are committed to ensuring equal opportunity in employment for qualified persons with disabilities. Please email accessibleinterviewing@samsara.com or click hereif you require any reasonable accommodations throughout the recruiting process.

Flexible Working 

At Samsara, we embrace a flexible working model that caters to the diverse needs of our teams. Our offices are open for those who prefer to work in-person and we also support remote work where it aligns with our operational requirements. For certain positions, being close to one of our offices or within a specific geographic area is important to facilitate collaboration, access to resources, or alignment with our service regions. In these cases, the job description will clearly indicate any working location requirements. Our goal is to ensure that all members of our team can contribute effectively, whether they are working on-site, in a hybrid model, or fully remotely. All offers of employment are contingent upon an individual’s ability to secure and maintain the legal right to work at the company and in the specified work location, if applicable.

Fraudulent Employment Offers

Samsara is aware of scams involving fake job interviews and offers. Please know we do not charge fees to applicants at any stage of the hiring process. Official communication about your application will only come from emails ending in ‘@samsara.com’ or ‘@us-greenhouse-mail.io’. For more information regarding fraudulent employment offers, please visit our blog post here.

Apply for this job

13d

Software Engineer, Web Frameworks

CloudflareHybrid or Remote
Bachelor's degreeDesignapic++typescriptangularjavascriptNode.js

Cloudflare is hiring a Remote Software Engineer, Web Frameworks

About Us

At Cloudflare, we are on a mission to help build a better Internet. Today the company runs one of the world’s largest networks that powers millions of websites and other Internet properties for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Position Location: Austin, TX | Lisbon, Portugal | London, UK

About the Role

Our team’s core mission is to enable developers to do what they do best — build powerful applications.  We believe they should be able to do this without having to think or worry about infrastructure, scaling, or performance. While Cloudflare Workers, Cloudflare’s solution to serverless computing, handles the infrastructure part, there’s so much more that goes into enabling developers to do their jobs. In this role you will work on a wide range of projects that enable our platform to integrate seamlessly with the existing Web development ecosystem, including developing and improving integration with full stack web frameworks, developer tools for bundling, transpiling, and performance optimizations. You’ll also be exposed to JS API design and standardization work, and development or integration of backwards/forwards compatibility API layers for Web and Node.js APIs. If this excites you, come join our team of talented engineers that enables developers all around the world to build low-latency planet-scale applications for the Internet and the Web!  

About the Department

Our team Frameworks and ecosystem is part of Cloudflare's Emerging Technology and Incubation (ETI) team where new, bold products are built and released within Cloudflare. Rather than being constrained by the structures which make Cloudflare a successful business, ETI leverages our network to deliver entirely new tools and products to our customers. Our most successful endeavors include the Cloudflare development platform, which is composed of Cloudflare Workers, Pages, R2, D1, and many other developer products.

What you'll do

As a member of the Frameworks & JS APIs team, you will put yourself in the shoes of developers using our development platform and make them successful in building their applications and deploying them on to our platform by creating and improving integrations with popular web frameworks, libraries, and tools. Along the way you’ll influence the JavaScript ecosystem by participating in designing JavaScript APIs, defining design patterns and architectures, as well as surfacing optimizations, that allow developers to build applications that take full advantage of our globally distributed, low latency network.

To this end, you will:

  • Collaborate closely with JavaScript web frameworks teams and tooling teams across the industry to ensure smooth development and production interoperability with our platform. Examples include Angular, Astro, Next, Nuxt, Qwik, Remix, Solid, SvelteKit, as well as Vite, Rollup, and many others.
  • Surface requirements and collaborate with internal teams to build features to support ecosystem integrations.
  • Contribute to open source projects across the web ecosystem in order to add features, fix issues, and improve integrations.
  • Build and improve libraries, and tools that improve ecosystem compatibility, and the getting started experience, like C3 (create-cloudflare CLI) and next-on-pages CLI.
  • Build demo applications, starter kits, and templates that enable developers to learn about our platform and get started using frameworks and libraries they are familiar with.
  • Participate in JavaScript API design efforts evolving our platform, as well as JavaScript standards.
  • Evaluate compatibility gaps between our workerd JavaScript runtime and Node.js, implement compatibility layers and polyfills to reduce developer friction when using existing libraries with our platform.
  • Contribute to internal and public-facing technical documentation, and author blog posts.
  • If applicable to ongoing projects, support the health and availability of services by being part of an on-call rotation.
  • Collaborate with engineers across Cloudflare, and contribute at many layers of the stack.
  • Leverage your creativity and developer prowess to seek out new ways to improve the platform.

About you

We want you to love it here! This role is a good fit for you if you are:

  • Excited by the idea of helping application developers be successful.
  • Experienced with and passionate about development tools, libraries, frameworks, and workflows.
  • Experienced in web application development, but attracted to digging a layer or two below to work on libraries, frameworks, and tools that power web application development.
  • Very experienced with JavaScript and TypeScript, web standards, JavaScript module systems, module resolution, code transformation, ASTs, and more.
  • Able to get familiar with internal architecture and workings of libraries and tools quickly, in order to propose integration strategies, or architectural adjustments.
  • Energized by mind-bending debugging sessions often involving unfamiliar code bases, complex build toolchains, and exotic bugs.
  • Excited to own your work from early discussions on.
  • Naturally curious and eager to take a step to learn something new, and share your learnings with others.
  • Above all, a collaborator and effective communicator. You want to join a team that upholds a culture of support, open and honest communication, and vulnerability, and that values collaboration over heroism. We celebrate our achievements, support each other when we make mistakes, and hold each other and our work to the highest standard.

You’ll really feel right at home if you have:

  • Experience using the Cloudflare Workers development platform
  • Experience contributing to OSS software development or maintaining OSS projects
  • Public speaking or developer relations skills

 

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job

13d

Systems Engineer, Workers Onboarding

CloudflareHybrid or Remote
Bachelor's degreesqlDesigngraphqlc++postgresqltypescriptkubernetesjavascriptfrontend

Cloudflare is hiring a Remote Systems Engineer, Workers Onboarding

About Us

At Cloudflare, we are on a mission to help build a better Internet. Today the company runs one of the world’s largest networks that powers millions of websites and other Internet properties for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Position Location: Austin, TX | Lisbon, Portugal | London, UK

About the Department

Emerging Technologies & Incubation (ETI) is where new and bold products are built and released within Cloudflare. Rather than being constrained by the structures which make Cloudflare a massively successful business, we are able to leverage them to deliver entirely new tools and products to our customers. Cloudflare’s edge and network make it possible to solve problems at massive scale and efficiency which would be impossible for almost any other organization.

The Workers team makes it possible for Cloudflare customers to run JavaScript and WebAssembly on Cloudflare's edge network. We build and maintain the serverless technology that executes billions of requests per month on behalf of developers and grants them nearly limitless control over how their requests are handled and responded to.

The Workers Onboarding team aims to provide the best in class experience for Workers users to move fast and quickly bring ideas to life.

What you will do

As a member of the Workers team, you will collaborate with Engineers, Designers, and Product Managers to design, build and support large scale, customer facing systems that push the boundaries of what is possible at Cloudflare's edge computing platform. You will drive projects from idea to release, delivering solutions at all layers of the software stack to empower the Cloudflare customers. You can expect to interact with a variety of languages and technologies including, but not limited to Go, JavaScript, Typescript, SQL, GraphQL, Rust, and C++.

Requisite Skills

  • 4+ years professional software engineering experience
  • Experience with large-scale systems
  • Must have strong experience with Javascript, Typescript, and one of the following: Go, C++, Rust
  • Experience working in frontend frameworks such as React
  • Experience with SQL and common relational database systems such as PostgreSQL
  • Experience with Kubernetes or similar deployment tools
  • Product mindset and comfortable talking to customers and partners
  • Experience delivering projects end-to-end – gathering requirements, writing technical specifications, implementing, testing, and releasing
  • Comfortable managing multiple projects simultaneously
  • Comfortable working on an oncall shift

Bonus Points

  • Experience with metrics and observability tools such as Prometheus, Grafana
  • Experience using Workers and Pages
  • Experience scaling systems to meet increasing performance and usability demands
  • Knowledge of OAuth and building integrations with third-parties
  • Has managed interns or mentored junior engineers

 

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job

13d

Software Engineer - Workers Core Platform

CloudflareHybrid or Remote
Bachelor's degreepostgressqlDesignapijavac++typescriptkubernetesjavascript

Cloudflare is hiring a Remote Software Engineer - Workers Core Platform

About Us

At Cloudflare, we are on a mission to help build a better Internet. Today the company runs one of the world’s largest networks that powers millions of websites and other Internet properties for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Locations: Austin TX 

About the Department

Emerging Technologies & Incubation (ETI) is where new and bold products are built and released within Cloudflare. Rather than being constrained by the structures which make Cloudflare a massively successful business, we are able to leverage them to deliver entirely new tools and products to our customers. Cloudflare’s edge and network make it possible to solve problems at massive scale and efficiency which would be impossible for almost any other organization.

The Workers teams makes it possible for Cloudflare customers to run JavaScript and WebAssembly on Cloudflare's edge network. We build and maintain the serverless technology that executes billions of requests per month on behalf of developers and grants them nearly limitless control over how their requests are handled and responded to.

The Workers Core Platform team delivers features that enable Cloudflare Workers customers to manage, configure and deploy their code. The team also ensures our critical core platforms scale and provide fundamental, reusable building blocks for customers.

What you will do

As a member of the Workers Core Platform team, you will collaborate with Engineers, Designers, and Product Managers to design, build and support large scale, customer facing systems that push the boundaries of what is possible at Cloudflare's edge computing platform. You will drive projects from idea to release, delivering solutions at all layers of the software stack to empower the Cloudflare customers. You can expect to interact with a variety of languages and technologies including, but not limited to Go, Kubernetes, Postgres SQL, Typescript, JavaScript, Rust. You will be expected to support the health and availability of critical services by being part of an on-call rotation.

Examples of desirable skills, knowledge and experience

  • 3+ years of professional experience building and managing software applications.
  • Understanding of computer science fundamentals including data structures, algorithms, object-oriented principles and API design.
  • Knowledge of at least one modern programming language such as Go, TypeScript, Rust, Java, C#, or JavaScript.
  • Experience in designing and architecting distributed systems.
  • Experience in designing and implementing REST APIs.
  • Experience working with cloud platforms, familiarity with cloud concepts.
  • Experience in SQL, familiarity with common relational database concepts.
  • Experience in testing, debugging, troubleshooting, optimizing and identifying possible failures.
  • Familiarity with the web and technologies such as web browsers, HTTP, JavaScript.
  • Familiarity with Kubernetes, Kafka, Clickhouse.

 

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job

13d

Développeur(euse) logiciel Full-Stack

DimonoffQuébec, Canada, Remote
laraveldockertypescriptjavascriptPHP

Dimonoff is hiring a Remote Développeur(euse) logiciel Full-Stack

Description du poste

Tu es une personne passionnée par le développement ? Un travail local qui a un impact mondial, ça te dit? Nous avons le poste parfait pour toi ! ????

Nous recherchons un(e) développeur(euse) logiciel Full Stack. Ton expertise sera une force au sein de notre équipe !

En tant que membre de notre équipe de développeur(euse) logiciel, tu joueras un rôle clé en participant au développement, à l’accompagnement et à la réalisation de projets d’envergures, au sein d’une équipe multidisciplinaires.

Voici de quoi seront composées tes journées :  

  • Définir et proposer des solutions techniques pour les clients
  • Développer des interfaces pour des objets connectés
  • Effectuer du code de qualité et les tests qui s’en suivent
  • Participer à la conception de l’architecture du logiciel plateforme
  • Évaluer et analyser l’architecture logiciel du produit développé 
  • Participer à la création de produits innovant
  • Continuer de te développer sur plusieurs technologies  

Qualifications

Nous recherchons une personne ayant :   

  • Connaissances de ces technologies (atout considérable) Go, PHP, Laravel, Javascript , Typescript, Docker, Vue.JS, Angular.JS

  • DEC en informatique et/ou BAC en informatique / Génie logiciel   

  • Minimum de 3-5 ans en développement de logiciel.

  • L’anglais ‘’lu’’ est un requis car tu seras amené(e) à lire de la documentation technique ou autre en anglais de différentes provenances (clients, littérature, réseaux etc.) 

  • Un désir d’apprendre et de cheminer dans l’entreprise   

See more jobs at Dimonoff

Apply for this job

13d

Intern Accounts Receivable Product Engineer

CelonisRemote, India
sqlDesignsasshtml5javatypescriptangularpythonbackendfrontend

Celonis is hiring a Remote Intern Accounts Receivable Product Engineer

We're Celonis, the global leader in Process Mining technology and one of the world's fastest-growing SaaS firms. We believe there is a massive opportunity to unlock productivity by placing data and intelligence at the core of business processes - and for that, we need you to join us.

The Team:

In our AR team at Celonis, we prioritize the timely collection of payments, fostering client relationships, and maintaining financial integrity. Much like Celonis’ Execution Applications tailored for specific business needs, we optimize our daily operations. Automation through Action Flows is key to driving value realization, mirroring our commitment to efficiency and excellence.

The Role:

As a Product engineer, you will be working along with Sr. team members member of development (frontend + backend) on the Accounts Receivables(AR) Product Development, implementing features and functionality of the AR execution App. Your work at Celonis will directly impact companies and people around the globe as they improve their processes to save money, reduce waste, improve automation, and generally become more efficient. 

If you are looking to be challenged in the front end and build solutions that scale, Celonis is the environment for you to thrive. There are a variety of tech stacks at Celonis, including but not limited to Angular, Typescript, HTML5, SASS, Python, Java, Vertica DB, and more. We focus on building beautiful, extensible, performant, and reliable applications.

The work you'll do:

  • Design and implement new user-facing features, visual components, and performant and scalable microservices
  • Write clean, understandable, and testable code
  • Manage individual project priorities, deadlines, and deliverables
  • Can solve complex problems with limited supervision
  • Document development procedures, concepts, and knowledge
  • Build, launch, and maintain features in production
  • Help define a fun and inclusive engineering culture  

The qualifications you’ll typically need:

  • Pursuing Bachelor/Master's degree in IT or Computer Eng. or equivalent practical experience
  • Should have good Aptitude, Analytical and Logical skill
  • Optional but good to have knowledge or experience of following technology stacks 
    • Frontend: Angular, TypeScript/JavaScript, HTML5, CSS/SCSS
    • Basic SQL Skills
    • Server: Java - Spring (boot), Python, NodeJS
    • Able to develop good REST APIs
  • Good communication and excellent collaboration skills
  • Passionate to learn and grow as a software engineer
  • Adaptable, result-oriented

What Celonis can offer you:

  • The unique opportunity to work with industry-leading process mining technology
  • Investment in your personal growth and skill development (clear career paths, internal mobility opportunities, L&D platform, mentorships, and more)
  • Great compensation and benefits packages (equity (restricted stock units), life insurance, time off, generous leave for new parents from day one, and more)
  • Physical and mental well-being support (subsidized gym membership, access to counseling, virtual events on well-being topics, and more)
  • A global and growing team of Celonauts from diverse backgrounds to learn from and work with
  • An open-minded culture with innovative, autonomous teams
  • Business Resource Groups to help you feel connected, valued and seen (Black@Celonis, Women@Celonis, Parents@Celonis, Pride@Celonis, Resilience@Celonis, and more)
  • A clear set of company values that guide everything we do: Live for Customer Value, The Best Team Wins, We Own It, and Earth Is Our Future

About Us

Since 2011, Celonis has helped thousands of the world's largest and most valued companies deliver immediate cash impact, radically improve customer experience and reduce carbon emissions. Its Process Intelligence platform uses industry-leading process mining technology and AI to present companies with a living digital twin of their end-to-end processes. For the first time, everyone in an organisation has a common language about how the business works, visibility into where value is hidden and the ability to capture it. Celonis is headquartered in Munich (Germany) and New York (USA) and has more than 20 offices worldwide.

Join us as we make processes work for people, companies and the planet.


Celonis is an equal opportunity employer. We celebrate diversity and are committed to creating an inclusive environment for all employees. Different makes us better.

Accessibility and Candidate Notices

See more jobs at Celonis

Apply for this job

13d

Staff Software Engineer, Refunds API

SquareAtlanta, GA, Remote
agilekotlinDesignapijavamysqltypescriptpythonAWSfrontend

Square is hiring a Remote Staff Software Engineer, Refunds API

Job Description

As a Software Engineer on the Refund API team, you will be responsible for designing, building, and maintaining the payment services and infrastructure that move money for Square. You will be deeply involved in the technical details of building highly available and reliable services, while also working with product teams to help Square to rapidly build new capabilities for our merchants and buyers all over the world.

You will:

  • Expand and maintain our Refunds APIs, used by both external developers (public docs) and Square products, an essential strategic asset of Square

  • Design and implement high-volume, low-latency, distributed transaction processing systems, making thoughtful tradeoffs between consistency and availability when both are not possible

  • Abstract away the legacy APIs of the financial world into consistent, coherent service APIs for Square and our sellers' products to build upon

  • Build systems that manage customers' sensitive data and hold Square to the highest standards for security and compliance

  • Mentor other engineers and contribute to the direction of the team

  • Participate in agile development processes, including stand-ups, sprint planning, and retrospectives

  • Work with our product, business, and finance teams to develop Square's global payments strategy

  • Focus on operational excellence to deliver fault-tolerant systems enabling team to move fast without negatively affecting our customers

Qualifications

You have:

  • 8+ years of software engineering experience

  • BA/BS degree in Computer Science or equivalent practical experience

  • Experience in the delivery of high-scale software solutions

  • Experience successfully leading complex projects and breaking down the work into components and milestones that can easily be picked up by other engineers

  • Eagerness to learn, share your ideas, and work with others

  • Willingness to collaborate and grow as an engineer

Even better:

  • Enterprise experience with JVM languages (Java, Kotlin)

  • Experience working building frontend components (Typescript, React)

  • Experience working in the payments industry

Technologies we use:

  • Java, Kotlin

  • Python, Typescript

  • Guice, Guava, Protocol Buffers, jOOQ, MySQL

  • AWS SQS, Lambda, DynamoDB

See more jobs at Square

Apply for this job

13d

Senior Full Stack Engineer

TruebillSan Francisco, CA, Washington, D.C., New York City, N.Y., Remote (USA)
postgresDesigngraphqlc++postgresqltypescriptbackend

Truebill is hiring a Remote Senior Full Stack Engineer

ABOUT ROCKET MONEY ????

Rocket Money’s mission is to empower people to live their best financial lives. Rocket Money offers members a unique understanding of their finances and a suite of valuable services that save them time and money – ultimately giving them a leg up on their financial journey.

ABOUT THE TEAM ????

Team Insight's mission is to support the personal finance features that make Rocket Money an integral part of our members’ everyday financial journey. Whether it’s tracking their spending, analyzing their recurring bills and subscriptions, or managing their transactions, Team Insight’s goal is to build incredible interfaces (and the backend services that power them) that make it easy for our members to understand their financial habits.

Team Insight owns the core personal finance features that all of our members use. If you’re excited about building highly scalable features that work on the scale of millions of monthly active users, this is the team for you.

IN THIS ROLE, YOU'LL:

  • Work alongside a team to implement, iterate, and debug product features that drive forward both the company and the user.
  • Own projects from end to end, making key decisions in the implementation of new features that balance technical concerns with business concerns.
  • Develop with TypeScript across the stack, building user interfaces using React Native and the backend support required to power them with Node & GraphQL.
  • Be a steward of good user experience, ensuring that the interfaces we present our users are performant, understandable, and delightful.
  • Help to maintain our high technical bar, participating in code reviews and design discussions to ensure that we're applying appropriate rigor to our software development process.
  • Develop an understanding of our users to build and measure features which help them better understand and improve their finances.

ABOUT YOU ????

  • You have 5+ years of professional experience working with some combination of Node/TypeScript, React, GraphQL, and Postgres (or similar relational database).
  • You're both a student and a teacher, continually seeking to grow as an engineer and help those around you grow as well.
  • You're not just interested in what you're building, but also why you're building it. You want to see the bigger picture of how the software you're building is benefitting our users.
  • Experience with our stack (TypeScript, React Native, PostgreSQL) is a plus.
  • You understand observability and enjoy digging into the details to solve performance and user experience issues.
  • You thrive in a growing organization, and are not afraid of a challenging problem. In fact, you confront problems head on and take the lead on the solution.

WE OFFER ????

  • Health, Dental & Vision Plans
  • Competitive Pay
  • Matching 401k
  • Unlimited PTO
  • Lunch daily
  • Snacks & Coffee 
  • Commuter benefits

Additional Information: Salary range of $150,000 - $185,000/year + bonus + benefits. Base pay offered may vary depending on job-related knowledge, skills, and experience.

Rocket Money is an Affirmative Action and Equal Opportunity Employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, or protected veteran status and will not be discriminated against on the basis of disability.

Pursuant to the San Francisco Fair Chance Ordinance, we will consider for employment qualified applicants with arrest and conviction records.

See more jobs at Truebill

Apply for this job

13d

Intermediate Full-Stack Software Developer

MedfarYerevan, Armenia, Remote
sqlDesignazurec++.nettypescriptangularjavascriptreactjs

Medfar is hiring a Remote Intermediate Full-Stack Software Developer

Job Description

As an Intermediate Full Stack Developer, you will be a member of the R&D Team and you will participate in the analysis, design, implementation and deployment of software tools and platforms that will be used by the other product development teams so that they can develop the healthcare field through new practices and technological innovations. 

You ideally have experience in developing large-scale software solutions, excellent leadership and communication skills, as well as a rigorous and analytical mindset with a data-driven problem-solving approach.

What you'll do:

  • Translate the needs and vision of the company into an adequate architecture (both software and hardware).
  • Select appropriate technologies and frameworks; ability to assess the impact of these choices on all business operations.
  • Design and develop robust, resilient, secure and scalable web application architectures, both front-end and back-end.
  • Participate in the continuous improvement of our software development processes.
  • Help support other team members in terms of coaching, supervision and code review.
  • Perform any other related tasks.

Qualifications

Contribute with your strengths:

  • College or university diploma in the field of software development or any other related field of expertise.
  • 3 to 5 years of experience in the architecture and deployment of systems in cloud computing environments.
  • Experience in test automation (unit, integration, front-end), with CI / CD pipelines, and DevOps processes.
  • In-depth knowledge of .NET application architecture and C # programming.
  • Advanced skills in JavaScript or Typescript programming.
  • Experience with a front-end framework (ReactJS, Angular, VueJS, etc.) as well as with SQL Server, SQL programming and performance analysis/optimization.
  • Knowledge of best security practices.
  • Ability to work as part of a team.
  • Ability to communicate fluently in English.
  • Experience in the health and medical IT field (asset).
  • Advanced knowledge of software architecture and infrastructure within the Microsoft Azure framework (asset).

See more jobs at Medfar

Apply for this job

14d

Senior Frontend Engineer, Supply and Demand Forecasting

WoltStockholm, Sweden, Remote
scalaiosandroidtypescriptpythonbackendfrontend

Wolt is hiring a Remote Senior Frontend Engineer, Supply and Demand Forecasting

Job Description

At the fast growing scale of the Wolt business our operational efficiency benefits greatly from having automation for managing supply (how many courier partners are online) and demand (how many orders are being placed by customers). For us it’s a clear win-win situation, but it takes an entire team to make sure that this is possible. ???? So, in order to achieve our mission to build the best tools for keeping the fine balance between supply and demand of delivery services at any given time and place, we’ve come to the point where we decided to strengthen our ranks by adding one more Frontend Engineer to our new Supply and Demand team to balance out our own team needs!

Supply and Demand team’s mission is to make Wolt cities efficient for our customers, merchants and couriers, as well as making running the cities smooth for our operations people. This is done by building tools and features that help achieve balance between supply (number of Courier Partners online) and demand (home delivery orders from consumers) by surfacing the forecasts to both our Courier Partners on the Courier App and and Wolt operations, as well as creating ways to dynamically influence the supply and demand. As a frontend engineer you will have a chance to work on our product from many angles: developing various features, working on the internal back office tool, implementing changes for the courier facing application, etc. At the moment, the team consists of one Frontend Engineer, several Backend Engineers and Data Scientist as well as Engineering Team Lead and Product Lead. The main programming languages on the team are Typescript (React), Python, and Scala and the team works closely with Data Scientists so this is a great chance to learn a lot about data science if you have a knack for it!

Lastly, this role can be based in one of our tech hubs in Helsinki or Stockholm, or you can work remotely anywhere in Finland, Sweden, Germany, Denmark, and Estonia. Read more about our remote setup here.

Qualifications

???? You have several years of experience experience using modern Typescript and React in the frontend and building solid scalable services and well-structured applications using them

???? If you have some React Native and app development experience (Android or iOS) on your hands - even better, we consider that a plus!

???? You’re a dedicated person who is pragmatic, doesn't shy away from going outside of their comfort zone, and demonstrates curiosity and willingness to keep continuously learning. 
So, TL;DR if you have several years of experience in dealing with the front end of the house, can’t wait to learn new things (including working with the backend side of things if you’re up for it), have an interest in tackling scalability challenges and building some cool stuff, then be sure to drop us a line! ????

#LI-LM_1

See more jobs at Wolt

Apply for this job

14d

Senior Cloud Platform Engineer

SignifydDenver, CO; New York City, NY; United States (Remote);
Bachelor degreeterraformDesignjavaelasticsearchmysqltypescriptkubernetespythonAWSjavascript

Signifyd is hiring a Remote Senior Cloud Platform Engineer

Signifyd is looking to hire a Senior Cloud Platform Engineer responsible for the design, implementation, and management of our cloud-based infrastructure. You will lead a team of highly skilled engineers maintaining and automating a vast cloud-based computing environment supporting Signifyd’s decision platform. The candidate will collaborate with development teams and fellow cloud infrastructure engineers to address critical issues. Proficiency in cloud technologies, containers, Kubernetes, networking, security, scripting, automation, and platform engineering, ensuring seamless system operations. The candidate should possess strong technical aptitude, software development skills, analytical and communication skills, and exceptional problem-solving ability. For this role, we are open to hiring an SE3 or SE4 level.

What You'll Do

  • Collaborate with cross-functional teams to design, build, and maintain highly available, scalable, and secure cloud-based services, promoting efficiency and self-service principles.
  • Develop and maintain automation scripts and tools to streamline infrastructure provisioning, configuration, and deployment, empowering engineering teams.
  • Implement and manage Kubernetes clusters for container orchestration, monitoring, and scaling.
  • Drive an evolution of services to support cloud-native managed services, including an evolution of Kubernetes.
  • Drive efforts to enhance cloud infrastructure security, including access controls, encryption, and vulnerability assessments, focusing on engineering security solutions.
  • Collaborate on CI/CD (TeamCity) pipelines to automate software deployment, including the build platform (Java, Gradle Enterprise) and QA/Testing tooling to drive DevEx up and CFR to zero, emphasizing engineering and self-service automation.
  • Define and maintain cloud engineering best practices and standards to ensure design and implementation consistency.
  • Collaborate with software engineers to optimize applications for cloud deployment, emphasizing performance and scalability.
  • Evaluate emerging cloud and DevOps technologies, providing recommendations for integration into cloud engineering practices.
  • Participate in capacity planning and resource optimization for cost-effective cloud infrastructure usage.
  • Troubleshoot complex engineering issues, provide root cause analysis and propose engineering-focused solutions.
  • Create and maintain comprehensive documentation related to the cloud infrastructure, engineering practices, and security configurations.
  • Mentor and provide technical guidance to junior team members, fostering a culture of excellence.

 

What You'll Need

  • Proficiency in cloud platforms (AWS, GCP) with a focus on engineering best practices.
  • Extensive expertise in Kubernetes (self-managed and cloud-managed flavors, architectures, operations, etc.), cloud infrastructure (AWS and GCP), and ideally databases (at least one of MySQL, Cassandra, DynamoDB, or Elasticsearch)
  • Deep knowledge of best practices for cloud environments, including security, cost optimization, operational excellence, reliability, and performance efficiency.
  • In-depth knowledge of networking principles, protocols, and security best practices for high-performance solutions.
  • Strong understanding of DevOps practices, CI/CD pipelines (TeamCity, GitHub Actions, AWS CodePipeline), and infrastructure-as-code tools (e.g., Terraform, Pulumi).
  • Excellent problem-solving skills, effective in a fast-paced, collaborative environment.
  • Excellent experience in Infrastructure-As-Code (IaC) best practices (Terraform).
  • Experience in software development in general, with skills in a high-level language (e.g., Python, JavaScript, TypeScript, Java) and familiarity with modern development practices
  • Understanding of Cloud Observability, Monitoring, and Tracing tools (Datadog, CloudWatch, Jaeger, ELK) and how best to leverage to support effective MTTR and mitigate high CFR

#LI-Remote
 

Benefits in our US offices:

  • Discretionary Time Off Policy (Unlimited!)
  • 401K Match
  • Stock Options
  • Annual Performance Bonus or Commissions
  • Paid Parental Leave (12 weeks)
  • On-Demand Therapy for all employees & their dependents
  • Dedicated learning budget through Learnerbly
  • Health Insurance
  • Dental Insurance
  • Vision Insurance
  • Flexible Spending Account (FSA)
  • Short Term and Long Term Disability Insurance
  • Life Insurance
  • Company Social Events
  • Signifyd Swag

We also want to provide an inclusive interview experience for all, including people with disabilities. We are happy to provide reasonable accommodations to candidates in need of individualized support during the hiring process.

Signifyd provides a base salary, bonus, equity and benefits to all its employees. Our posted job may span more than one career level, and offered level and salary will be determined by the applicant’s specific experience, knowledge, skills, and abilities, as well as internal equity and alignment with market data.

USA Base Salary Pay Range
$160,000$200,000 USD

See more jobs at Signifyd

Apply for this job

14d

Senior Software Engineer, D1

CloudflareHybrid or Remote
Bachelor's degreejavac++typescriptjavascriptbackendfrontend

Cloudflare is hiring a Remote Senior Software Engineer, D1

About Us

At Cloudflare, we are on a mission to help build a better Internet. Today the company runs one of the world’s largest networks that powers millions of websites and other Internet properties for customers ranging from individual bloggers to SMBs to Fortune 500 companies. Cloudflare protects and accelerates any Internet application online without adding hardware, installing software, or changing a line of code. Internet properties powered by Cloudflare all have web traffic routed through its intelligent global network, which gets smarter with every request. As a result, they see significant improvement in performance and a decrease in spam and other attacks. Cloudflare was named to Entrepreneur Magazine’s Top Company Cultures list and ranked among the World’s Most Innovative Companies by Fast Company. 

We realize people do not fit into neat boxes. We are looking for curious and empathetic individuals who are committed to developing themselves and learning new skills, and we are ready to help you do that. We cannot complete our mission without building a diverse and inclusive team. We hire the best people based on an evaluation of their potential and support them throughout their time at Cloudflare. Come join us! 

Available Locations: Austin, Texas | Lisbon, Portugal | London, UK

About the Department

Emerging Technologies & Incubation (ETI) is where new and bold products are built and released within Cloudflare. Rather than being constrained by the structures which make Cloudflare a massively successful business, we are able to leverage them to deliver entirely new tools and products to our customers. Cloudflare’s edge and network make it possible to solve problems at massive scale and efficiency which would be impossible for almost any other organization.

What you'll do

We announced Cloudflare Workers in 2017  — since then it’s played a key role in Cloudflare’s strategy for entering the developer platform market. Until the launch of Workers, as Cloudflare was ramping up its capabilities in the performance and security spaces, it became clear that developers needed more ways to control the edge than rules engines could support. Workers has allowed Cloudflare to add programmability to the edge such that developers could have access to writing logic on the edge in their preferred way — through code. Over the past few years, Workers has grown from a simple functions-as-a-service option into a fully blown full-stack platform. With any application, however, in addition to serverless compute, you need to be able to manage state. In 2022, Cloudflare released D1 — built on Durable Objects, D1 is Cloudflare’s first serverless database.  In this role, you’ll be helping define and building the future of D1 to enable developers to build full stack applications. 

Examples of desirable skills, knowledge and experience

  • 5+ years experience building full-stack web applications.
  • Knowledge of Javascript, preferably Typescript, for both frontend and backend application development.
  • Knowledge of at least one modern strongly-typed programming language such as Go, Java, C#, Rust, or C++.
  • Experience operating high volume Software-as-a-Service (SaaS) applications.
  • Experience designing and building library and REST APIs
  • A solid understanding of computer science fundamentals including data structures, algorithms, and object-oriented or functional design.

Bonus Points

  • A thorough understanding of database internals such as SQLite and Postgres.
  • A thorough understanding of the web and technologies such as web browsers, HTTP, JavaScript and WebAssembly.
  • Experience building developer platforms and/or tooling.
  • Experience developing on open source software projects.

What Makes Cloudflare Special?

We’re not just a highly ambitious, large-scale technology company. We’re a highly ambitious, large-scale technology company with a soul. Fundamental to our mission to help build a better Internet is protecting the free and open Internet.

Project Galileo: We equip politically and artistically important organizations and journalists with powerful tools to defend themselves against attacks that would otherwise censor their work, technology already used by Cloudflare’s enterprise customers--at no cost.

Athenian Project: We created Athenian Project to ensure that state and local governments have the highest level of protection and reliability for free, so that their constituents have access to election information and voter registration.

Path Forward Partnership: Since 2016, we have partnered with Path Forward, a nonprofit organization, to create 16-week positions for mid-career professionals who want to get back to the workplace after taking time off to care for a child, parent, or loved one.

1.1.1.1: We released 1.1.1.1to help fix the foundation of the Internet by building a faster, more secure and privacy-centric public DNS resolver. This is available publicly for everyone to use - it is the first consumer-focused service Cloudflare has ever released. Here’s the deal - we don’t store client IP addresses never, ever. We will continue to abide by our privacy commitmentand ensure that no user data is sold to advertisers or used to target consumers.

Sound like something you’d like to be a part of? We’d love to hear from you!

This position may require access to information protected under U.S. export control laws, including the U.S. Export Administration Regulations. Please note that any offer of employment may be conditioned on your authorization to receive software or technology controlled under these U.S. export laws without sponsorship for an export license.

Cloudflare is proud to be an equal opportunity employer.  We are committed to providing equal employment opportunity for all people and place great value in both diversity and inclusiveness.  All qualified applicants will be considered for employment without regard to their, or any other person's, perceived or actual race, color, religion, sex, gender, gender identity, gender expression, sexual orientation, national origin, ancestry, citizenship, age, physical or mental disability, medical condition, family care status, or any other basis protected by law.We are an AA/Veterans/Disabled Employer.

Cloudflare provides reasonable accommodations to qualified individuals with disabilities.  Please tell us if you require a reasonable accommodation to apply for a job. Examples of reasonable accommodations include, but are not limited to, changing the application process, providing documents in an alternate format, using a sign language interpreter, or using specialized equipment.  If you require a reasonable accommodation to apply for a job, please contact us via e-mail athr@cloudflare.comor via mail at 101 Townsend St. San Francisco, CA 94107.

See more jobs at Cloudflare

Apply for this job