laravel Remote Jobs

191 Results

9d

PHP Developer (All Levels)

First FactoryRemote job, Remote
laraveljquerygitc++dockermysqlcsskubernetesjavascriptPHP

First Factory is hiring a Remote PHP Developer (All Levels)

First Factory is constantly growing and is always looking for the best software developers. If you are looking for a new opportunity to work on a project for online educational solutions in a results-driven and selfless way with a relentless focus on our customers' environment, this might be the perfect project for you.


The ideal team player will have the responsibility of developing, testing, implementing, and maintaining software applications in a for-profit organization working across a variety of technologies, with a focus on development in PHP.

First Factory might be the place for you if:

  • You’re enthusiastic about software development and emerging technologies

  • You’re a voracious learner who is always looking to get better and improve your skills for career development and growth

  • You enjoy helping others succeed and helping them identify resources to grow

  • You’re flexible and can adapt to changing needs while still producing quality work

  • You’re highly collaborative in an environment that is more start-up than a big company

  • You demonstrate advanced English proficiency and excellent communication skill

16d

Senior Software Engineer

Bachelor's degreelaravelDesignapiqamysqllinuxAWSfrontendPHP

Advice Media is hiring a Remote Senior Software Engineer

Senior Software Engineer

As MyAdvice's Senior Software Engineer, you will work with our team of developers to create and enhance features in our cutting-edge marketing platform. You will be hands-on in developing all layers of our platform, from third party API integrations to client facing UI/UX. The ideal candidate will have a working knowledge of PHP/Laravel/Lumen and any number of Frontend JS libraries. Being a Senior Software Engineer, you may be required to direct the work of junior developers, including code review. Work is typically independent, yet collaborative in nature.

*This position can be remote, hybrid or in-office depending on candidate preference and location.MyAdvice has offices in Melville, New York, Lehi, Utah and Lakewood, Colorado. 

*Candidates must complete a code assessment to demonstrate required skills.Only applicants who complete the assessment will be considered for the role.

Essential Duties

  • Guide development team towards successful feature delivery within MyAdvice's proprietary marketing platform
  • Provide technical leadership to teammates through coaching, mentorship and code review
  • Maintain high quality standards by establishing and enforcing company-wide best practices
  • Actively participate in all agile/scrum related activities

Required Qualifications

  • 5+ years of experience coding with PHP
  • 3+ years experience with the Laravel and Lumen framework(s), MySQL and Vue.js, or similar
  • Experience integrating with third party APIs
  • Ability to QA your own work as well as others
  • Self-starter with the ability to research and resolve issues
  • Comfort working in a deadline-driven environment
  • Bachelor's degree or equivalent work experience 
  • Fluency in written and spoken English 

Preferred Skills

  • Working knowledge of Linux scripting
  • Competent with basic screen design
  • Familiar with testing frameworks
  • Experience with CI/CD and working with AWS services

Benefits + Compensation

  • $90k-$115k Starting Salary; Full-time Position 
  • Schedule: Monday-Friday with choice of preferred office hours
  • Employer Paid Plans: Medical (80%), Vision, Life, Long-term Disability and AD+D Insurances
  • Voluntary Plans: Dental, Short Term Disability, Critical Illness, Accident and Pet Insurances
  • Unlimited Paid Time Off + 13 Paid Holidays, Flex Schedule Policy and Early Out Fridays!
  • 401(k) Plan with Company Match (50% of the first 6% invested)
  • Tuition Reimbursement Program and Executive Mentorship Opportunities
  • Employee Assistance Program (mental health services, financial/legal consultations and more!)
  • Casual Dress and Fun Work Environment (foosball, beer fridge, coffee, snacks, etc.)
  • Day of Creativity, Core Value "Pay It Forward" Initiative, Quarterly Employee and Volunteer Activities
  • 12 Week Maternity Leave Policy

Travel Requirement

  • May require occasional local or national travel (less than 5% of the time, if any)

Physical Requirements

  • Prolonged periods sitting at a desk and working on a computer (90% at desk, 10% of time walking)
  • Will work in office environment using typical office equipment (computers, keyboards, printer, etc.)
  • Ability to lift up to 30 lbs

MyAdvice

MyAdvice empowers business owners and professionals to increase their revenue by attracting and retaining more clients through digital marketing. The SaaS-based platform enables hands-on control and visibility into performance of online marketing activities, backed by 20+ years of best practices and expertise on how to maximize those efforts. MyAdvice’s six-stage Pyramid of Success™ provides a proven step-by-step plan for how and when to implement growth-oriented marketing tactics for greatest impact, including website design and maintenance, local directories, client reviews, social media, search engine optimization (SEO) and paid advertising. Learn more at myadvice.com.

We are committed to diversity and inclusion as we understand and value its importance to our success. Our team thrives upon our employee's unique experiences to propel creative solutions, so we aspire to continue building upon our diverse team to include groups that are traditionally underrepresented. We strongly encourage people of all backgrounds to apply.

MyAdvice is a performance based and data driven company that has experienced tremendous growth within the last year, so we're excited for the opportunity to introduce new talent. MyAdvice’s progressive values include transparency, teamwork, relentless effort and intellectual honesty in order to bring about the success of our clients. We encourage continuous education, career development and work/life balance while thriving in a casual and collaborative work environment. With MyAdvice you will be a valued and integral member whom we will continually invest.

See more jobs at Advice Media

Apply for this job

18d

Site Reliability Engineer (Laravel/Vue/AWS/ECS) at

terraformlaravelapimysqljavascriptfrontendPHP

SportsRecruits is hiring a Remote Site Reliability Engineer (Laravel/Vue/AWS/ECS) at

About SportsRecruits

SportsRecruits is the leading sports recruiting network, connecting athletes, clubs, events, and college coaches in the recruiting process. The company’s network and tools are trusted by sports organizations such as the IWLCA, IMLCA, and Junior Volleyball Association. Every year, millions of connections are made on the network, resulting in commitments to the best academic and athletic institutions.

SportsRecruits is an equal opportunity employer and embraces diversity and equal opportunity on our team. Just like the student-athletes we support, we are trying to get better and stronger as a team everyday.  We are committed to building a team that represents a variety of backgrounds, perspectives, and skills.  We strongly believe that the more inclusive our team is, the better we can serve all student-athletes, as well as their families and coaches, who are pursuing their dreams. 

About the Position

We are a product development team full of fun, intelligent, happy, and hardworking engineers, designers and product managers distributed across the United States. We are profitable, funded and giving more high school athletes the ability to play college athletics than any other recruiting tool out there. Your input and coding/problem solving skills will make a direct impact in how we scale and grow the company.  

We are looking for an SRE to join our team working remotely. We are looking for someone who is a programmer first and is capable of debugging code, refactoring code and writing tests. Our two main technologies that we are investing most of our resources in are Laravel (a modern PHP framework), which we use for our API and Vue.js (javascript frontend framework), which currently powers the frontend application. 

As a Site Reliability Engineering on the Infra/DevOps team, you will take over setting up incident response protocols, Continuous Integration pipeline, Performance indicators and reduction of technical debt, diagnose and identify issues coming from Newrelic and Sentry.  

You will spearhead SRE practices like: 

  • Track performance indicators ranging from Core Web Vitals to DB queries per transaction, failures per request, currently all monitored using NewRelic and Sentry. 
  • Set up performance targets and identify most impactful projects to improve performance metrics across the existing platform features. SLIs & SLOs 
  • Tackle technical debt projects which inhibit performance
  • Write scalable code and optimizations across Javascript, JS/CSS assets, CDN, PHP cycles, Memory usage and DB query performance 

You will aid with devops / infrastructure responsibilities: 

  • Help manage dev and production infrastructure currently running on ECS-Fargate and leveraging Terraform

Requirements: 

  • 5+ years of experience developing web based applications
  • Strong knowledge of OOP, refactoring, and unit testing
  • Advanced working knowledge of ORMs, MySQL and MySQL optimization
  • Comfortable with command line tools 
  • Experience debugging applications based on Javascript and PHP 
  • Laravel PHP experience is a big plus 
  • VueJS experience is a big plus  

Nice to have: 

  • Nice to have: Interest and some experience in DevOps, SRE, or related roles
  • Experience working with CI tools
  • Experience managing Infrastructure as code using Terraform or CloudFormation

What we offer:

It’s important to us that our team is happy, and we're always looking for ways to improve our overall work culture and support our employees’ well-being. Here are a few of the benefits we offer at this time:

  • Comprehensive medical, vision, and dental coverage
  • 401(k)
  • Unlimited time-off policy
  • Option to work remote or in our future office

This is a full time position available as remote or in NYC, no freelancers please.  Principals only, no recruiters please. 

 

See more jobs at SportsRecruits

Apply for this job

19d

PHP Developer

RTB HouseRemote, Warsaw, Poland
sqllaravelvuesymfonylinuxangularPHP

RTB House is hiring a Remote PHP Developer

Description

Obowiązki:

  • tworzenie narzędzi mających na celu automatyzację i optymalizację procesów finansowych i sprzedażowych w firmie;
  • obsługa i rozwój istniejących rozwiązań wspomagających codzienną pracę zespołów finansowych i sprzedażowych;
  • testowanie kodu;
  • czuwanie nad jakością tworzonego kodu.

Oczekiwania:

  • bardzo dobra znajomość PHP7;
  • bardzo dobra znajomość SQL;
  • przynajmniej podstawowa umiejętność obsługi Linux;
  • doświadczenie w programowaniu aplikacji webowych;
  • wysoka motywacja do pracy oraz orientacja na realizację wyznaczonych celów;
  • umiejętności analityczne i organizacyjne;
  • bardzo dobra znajomość języka polskiego oraz znajomość języka angielskiego umożliwiająca swobodne czytanie i pisanie.

Mile widziane:

  • znajomość frameworka Laravel i/lub Symfony;
  • znajomość Dockera;
  • doświadczenie z nowoczesnymi frameworkami frontendowymi (React, Vue, Angular);
  • zainteresowanie tematyką finansową.

 Oferujemy

  • udział w jednym z najciekawszych projektów branży online zarówno w Polsce, jak i w skali globalnej;
  • pracę w jednej z najszybciej rozwijających się firm technologicznych w Europie;
  • atrakcyjne wynagrodzenie;
  • pracę przy różnorodnych projektach i ciągłym rozwoju oprogramowania;
  • nieformalną oraz przyjazną atmosferę i bycie częścią zespołu osób o ciekawych doświadczeniach i zainteresowaniach;
  • współfinansowanie kursu języka obcego oraz szkoleń;
  • ciągły rozwój zawodowy oraz możliwość podnoszenia kwalifikacji.

See more jobs at RTB House

Apply for this job

+30d

Back-End Developer (PHP/Laravel)

sqllaravelvuesassapiqagitcssangularpythonbackendPHP

Vista Projects Limited is hiring a Remote Back-End Developer (PHP/Laravel)

CurrentSCM

 

Current and Vista Projects are looking for a backend-focused full-stack developer to join our growing team. CurrentSCM is a business focused SAAS offering focused on Supply Chain and Material Management.

The ideal candidate will be willing to dive into the full-stack, but happy to focus the bulk of their time on backend activities. We are a tight-knit team that is willing to dive headfirst into challenges to support our teammates and our client base.

About Current

Current SCM is a first of its kind – a procurement and materials management software built by procurement professionals for sophisticated procurement teams. It’s a powerful all-in-one solution designed to quickly ramp up and ramp down procurement projects of any size. Current was developed out of necessity by Vista Projects, a longstanding industrial engineering firm and perennial Great Place to Work. For Current SCM team members, this means you would get the best of both worlds:

  • High Growth Potential: to grow your career around the exciting opportunities of a SaaS start-up
  • Limited Risk: backed by the perks and stability of an established best employer

Current SCM was built for the long term. After years of carefully planned development, this enterprise-grade multitenant software-as-a-service is ready to begin its commercial journey, with you at the helm! We look forward to the right candidates joining our growing tight-knit team. Together, we will dive headfirst into challenges to support our teammates and our client base.

Why We Built Current SCM

We believe the world needs industrial projects and that intelligent data management systems can increase the likelihood of innovative solutions getting to market. Having experienced the challenges first-hand, there was clearly a void in the market for project-based, 3rd party procurement and materials management software.

Where We Work

While Current was built for the complexity of largescale industrial projects, the software capabilities will benefit several industries, including:

  • Construction and engineering
  • Energy and utilities
  • ETO and contract manufacturing

Job Location

This is a remote position with an option to work from headquarters in Calgary, Alberta. The Back-End Developer is expected to travel to Calgary for quarterly team meetings.

Main Duties and Competencies

  • Developing software and API integrations
  • Analyzing, designing, programming, compiling, debugging, supporting, and modifying software, enhancements, add-ons, and integrations for new and existing product offerings
  • Evaluating technical needs in relation to proposed solutions
  • Supporting DevOps initiatives including CI/CD pipelines, containerized dev environments, etc.
  • Developing unit, feature and integration tests
  • Demonstrating sound judgement while still thinking strategically, creatively, and fostering innovation
  • Providing technical leadership to less experienced developers and provide constructive criticism to help make the team stronger
  • Completing code review and other QA centric activities
  • Following Vista’s programming guidelines and standards and enforces them amongst other team members
  • Working collaboratively with other stakeholders including subject matter experts, front-end engineering, QA and Sales Teams
  • Performing other duties as required

Requirements 

  • Strong working knowledge of progressive JS frameworks (e.g. Vue, React, Angular)
  • Strong working knowledge of SASS and CSS
  • Strong working knowledge of Git
  • Demonstrated experience consuming and interacting with APIs
  • Comfort using and developing CLI tools to support development, testing and deployment
  • The ability to clearly communicate complex technical subjects to all kinds of stakeholders in different mediums.

 Preferred Experience

  • Strong working knowledge of Laravel
  • Experience configuring and working in containerized environments.
  • Experience in conjuring and maintaining CI/CD pipelines.

What We Offer

An opportunity with Vista is not just a job; it is a chance to tackle challenging projects with colleagues who are among the most recognized and accomplished in their disciplines. 

Vista offers all employees

  • A stimulating, fast-paced and challenging work environment where you will contribute to the interesting municipal and industrial engineering projects 
  • A robust and consistent recruitment process that ensures your colleagues are likeminded and comparably capable 
  • An opportunity to be a part of an entrepreneurial, technically skilled team which has established leadership in innovative engineering solutions 
  • A strong value-based philosophy that provides an informal, close-knit team environment, where you and your family feel like a part of our organization, and not just an employee number 
  • Competitive compensation and benefits, including a performance-linked variable pay program 
  • Company-sponsored social events and team sports 
  • Flexible work schedules, half-day Fridays and free parking 
  • An organization that values and encourages diversity 

How To Apply

Please complete the application form below and include a cover letter concisely demonstrating how your skills and experience align with our job posting. By submitting this application, you consent to our Privacy Policy, and you consent to receive commercial electronic messages from Vista and third parties acting on our behalf.

Note:As part of the interview process there will be a technical testing component that will take up to two hours and can be completed at home on your own timelines. Candidates may be required to complete a security clearance procedure prior to receiving an offer.

See more jobs at Vista Projects Limited

Apply for this job

+30d

Web Developer

MessageMediaPhilippines Remote
agilelaravelcssjavascript

MessageMedia is hiring a Remote Web Developer

ClickSend is a global leader in business communication solutions. Our reputation is built on technical expertise, industry experience, quality support and service reliability. We are a business communications software company that provides companies of all shapes and sizes the ability to easily send and receive SMS, MMS, Rich Media, Email, Voice and even Post worldwide via web, app, or API. From bulk marketing to mission-critical solutions, we provide the telecommunications glue that connects the world.

We’re a small team based in Perth, Western Australia, but we’re a global brand with a presence in the US, UK, and Philippines. We’re creative problem solvers and we get stuff done but in a relaxed environment that’s not big on overly structured hierarchies. We’re a mixed bag of young and old from all corners of the globe. We’re part of the MessageMedia Group (based in Melbourne) and have all the benefits of being part of a larger group but we retain our ‘start-up’ mentality. We maintain a spectacular work-life balance and try to mix a little fun and music into our days.

MessageMedia Group is proudly part of Sinch, a leading global Communication Platform as a Service (CPaaS) provider, offering messaging, voice and video communication solutions to a large global customer base.

ClickSend is looking to recruit a Web Developer to work remotely from the Philippines. This role is a contract role for initially 12 months with a high possibility of an ongoing contract.

Reporting to the Development Manager, located in Western Australia.

Key responsibilities:

  • Work closely with your team and participate in stand-ups, grooming, sprint planning and repos.
  • Work on development of variety of internal and external applications, from the customer portal, customer service portal (for internal staff), our print room management software, and the static web site.
  • Implement the web-based front end to the APIs and deliver beautiful front-end experiences to the customers and internal staff.
  • Troubleshoot any technical problems with the application/platform.
  • End to end delivery from creation to testing and deployments.
  • Stay ahead of any new features and functionality as well as provide recommendations for improvements.

Skills and Qualifications:

  • Bachelor’s Degree in Information Technology, Computer Science and other related fields is preferred but not required
  • At least 3 years of relevant work experience in web application/website development using JavaScript, VUE.JS, Laravel and CSS
  • Ability to use JS frameworks to call REST endpoints
  • Experience in multi browser development
  • Experience in Agile development
  • Passion for a clean and beautiful code with an eye for simplicity
  • Excellent verbal and written English communication skills
  • Strong analytical skills and ability to solve complex issues.
  • Ability to work independently with minimal guidance
  • Ability to work collaboratively with cross-functional and virtual teams.

Our values of dream big, win together, keep it simple and make it happenare what make us successful on our journey to be the global leader in customer engagement for SMBs, so people who feel a connection to these values and like the pace of a fast-growing global company will easily fit into our team.

If development is your passion and working with people in high-performing environments is what you like to do then this could well be the role for you. We are looking to start someone as soon as possible so apply today and let’s talk real soon.

See more jobs at MessageMedia

Apply for this job

+30d

Full Stack Software Engineer

sqltailwindlaravelDesignvuemobilemongodbscrumreact-nativepostgresqlmysqllinuxAWSjavascriptPHP

SportsRecruits is hiring a Remote Full Stack Software Engineer

About SportsRecruits

SportsRecruits is the platform that provides clubs, student-athletes and their families access to every college coach in the country. Club and high school organizations use our platform to empower their student-athletes in the recruiting process and oversee their efforts and communication with complete transparency. Connections made on the platform have resulted in commitments to the best academic and athletic institutions across the country.

 

SportsRecruits is an equal opportunity employer and embraces diversity and equal opportunity on our team. Just like the student-athletes we support, we are trying to get better and stronger as a team everyday. We are committed to building a team that represents a variety of backgrounds, perspectives, and skills. We truly believe that the more inclusive our team is, the better we can serve all student-athletes, as well as their families and coaches, who are pursuing their dreams.

 

About the Team

We are a product development team full of fun, intelligent, happy, and hardworking engineers, designers and product managers distributed across the United States. We are profitable, funded and giving more high school athletes the ability to play college athletics than any other recruiting tool out there. Your input and coding/problem solving skills will make a direct impact in how we scale and grow the company.  

 

About the Position

We are looking for a senior front-end developer that will take ownership of maintaining and building new Javascript components, profiling front-end application performance, instilling best practices, mentoring and learning with other engineers, and working with the design team to iterate on our digital design system, style guide, and application user interface.  

This role will guide the front-end development for all client-facing digital products including websites, mobile apps, and other software efforts.

This position will be reporting to the Director of Product Engineering. This is a remote role on a remote team working across the United States. If you are located in NYC, you will have the option to go into our downtown Manhattan Wework office if you choose to. 

You will contribute to solving complex problems that will make our platform even better at connecting thousands of student athletes and college programs. Some interesting projects we’ve recently worked on are:

  • In-browser video clipping and editing for making highlight reels 
  • Robust player search and matching for college coaches 
  • React-native based hybrid iOS/Android app for recruiting events scheduling
  • Tools for partner events to import rosters of athletes with built-in column mapping, de-duping and validation rules to automatically merge duplicate user data 

 

About you:

  • Several years as a professional software developer with experience in 2+ languages
  • Experience in one or more modern MVC frameworks (e.g. Laravel, Rails, Django)
  • Stack alignment isn’t a requirement, but you have the ability to learn and adapt to our tech stack: Vue / Laravel / React Native
  • Built high-quality, performant, maintainable software incrementally and pragmatically
  • Used context-appropriate automated testing to inform software design choices and increase confidence in deliverables and refactoring
  • Debugged, tested, and refactored pre-existing code to incrementally improve it
  • Understands cross-browser issues and debugging
  • Passionate about Object-Oriented Design & clean code
  • Has experience working with relational databases (MySql, SQL Server, Postgresql)

 

Nice to have:

  • Experience with Laravel / Vue / Tailwind
  • DevOps / Ops / Linux / AWS experience
  • Scrum / XP / Kanban experience
  • PHP knowledge / experience
  • Experience working with 3rd party APIs
  • MySql / Redis / MongoDB experience
  • In-depth knowledge of testing and TDD

Personal:

  • Mentored and shared knowledge with colleagues, adapted to suggestions, made thoughtful recommendations to your team, and worked collaboratively
  • Independent, self-motivated, inquisitive
  • Growth-oriented mindset: consistently learning and experimenting with new ideas, techniques, and paradigms; seeks out feedback
  • Proactive and positive attitude

Perks:

  • Unlimited PTO through our “Personal Responsibility Vacation Policy”
  • Health/Dental/Vision insurance
  • Start to finish project ownership
  • Travel to NYC a few times per year for team building events

 

See more jobs at SportsRecruits

Apply for this job

+30d

PHP Backend Developer

4 years of experiencelaravelscrumapisymfonygitAWSbackendPHP

ActiveProspect, Inc. is hiring a Remote PHP Backend Developer

Company Overview

LeadsBridge is a fast-growing automation solution that focuses on connecting top advertising platforms - Google, Facebook, LinkedIn, and TikTok - with main marketing tools - CRM, email marketing software, autoresponder, and so much more. With ready-made and custom-made integrations, LeadsBridge builds automated workflows that allow sending lead data from a source into a destination of choice in real-time, while always maintaining CCPA and GDPR compliance.

With thousands of customers spanning the globe across industries, LeadsBridge was recently added to ActiveProspect’s product portfolio, representing a step forward to making consent-based marketing the BEST channel for customer acquisition & lead generation across the world.

 

#TogetherIsBetter is one of our mottos.

This is a short video during our last mega camp, let’s get loud!

2021https://www.linkedin.com/feed/update/urn:li:activity:6841397149717164033

Job Summary

As a Senior Backend Engineer on the LeadsBridge team, you will play a vital role in maintaining and adding features to the LeadsBridge product. You will join our team of back-end developers bringing value to our product according to SCRUM methodology, through 2w iterations, working on a prioritized backlog and on user stories defined by the Product team and Product Owner.

As such, you will:

  • Ship clean, well-tested code to production on a regular basis
  • Work closely with the LeadsBridge engineers and the Product Owner to develop new cool features
  • Participate in planning and estimating to continuously improve the product
  • Perform code reviews and share code with other engineers
  • Provide input and technical direction for backend development
  • Contribute to the migration of our PHP legacy application to the new Laravel app (ETA 1 year)
  • Wrote and update technical documentation
  • Participate in bootcamps in Italy and around the world where you can finally meet "in person" your colleagues, exchange ideas and thoughts, do team-building activities and together contribute to creating a better LeadsBridge.

As such, you will:

  • Ship clean, well-tested code to production on a regular basis
  • Work closely with the LeadsBridge engineers and the Product Owner to develop new cool features
  • Participate in planning and estimating to continuously improve the product
  • Perform code reviews and share code with other engineers
  • Provide input and technical direction for backend development
  • Contribute to the migration of our PHP legacy application to the new Laravel app (ETA 1 year)
  • Wrote and update technical documentation
  • Participate in bootcamps in Italy and around the world where you can finally meet "in person" your colleagues, exchange ideas and thoughts, do team-building activities, and together contribute to creating a better LeadsBridge.

 

Qualifications and Skills

  • More than 4 years of experience working as a backend developer
  • Strong knowledge of Laravel framework
  • Strong knowledge of Vanilla PHP and Object-Oriented Programming
  • Familiarity with REST/SOAP API
  • Proficient with Git
  • Fluent Italian
  • Highly proficient in spoken and written English
  • Driven to continue learning and exploring
  • Open-minded and passionate about solving problems

How to Stand Out 

  • Familiarity with PHPUnit or Pest
  • Familiarity with other PHP popular frameworks (Symfony, Yii, etc.)
  • Experience with AWS (S3, Dynamo, SQS, etc.)
  • Within 2 hours of Central European Time

Benefits and Perks

  • Work remotely → live and work wherever you like. Remote: 
  • Vacation → at least 4 weeks/year
  • Career Path→ if you are looking for a transparent, growing career, LeadsBridge is the right choice!
  • Retreats → meet your colleagues twice per year! Our next retreat camp will be in Sep/2022 in…
  • Monthly benefit → $150/mo that you can spend for working appliances, gym, training (or any wellness activities), buy books/courses and cover connectivity costs.

LeadsBridge (now an ActiveProspect business)  is an Equal Opportunity Employer.

As a part of being an equal opportunity employer, we are passionate about working with talented and empathetic people. As such, we want you to bring your authentic self to work every single day. We accept you for who you are and consider everyone on an equal opportunity basis.

 

See more jobs at ActiveProspect, Inc.

Apply for this job

+30d

Senior Backend Engineer

4 years of experiencelaravelscrumapisymfonygitAWSbackendPHP

ActiveProspect, Inc. is hiring a Remote Senior Backend Engineer

Company Overview

LeadsBridge is a fast-growing automation solution that focuses on connecting top advertising platforms - Google, Facebook, LinkedIn, and TikTok - with main marketing tools - CRM, email marketing software, autoresponder, and so much more. With ready-made and custom-made integrations, LeadsBridge builds automated workflows that allow sending lead data from a source into a destination of choice in real-time, while always maintaining CCPA and GDPR compliance.

With thousands of customers spanning the globe across industries, LeadsBridge was recently added to ActiveProspect’s product portfolio, representing a step forward to making consent-based marketing the BEST channel for customer acquisition & lead generation across the world.

 

#TogetherIsBetter is one of our mottos.

This is a short video during our last mega camp, let’s get loud!

2021https://www.linkedin.com/feed/update/urn:li:activity:6841397149717164033

Job Summary

As a Senior Backend Engineer on the LeadsBridge team, you will play a vital role in maintaining and adding features to the LeadsBridge product. You will join our team of back-end developers bringing value to our product according to SCRUM methodology, through 2w iterations, working on a prioritized backlog and on user stories defined by the Product team and Product Owner.

As such, you will:

  • Ship clean, well-tested code to production on a regular basis
  • Work closely with the LeadsBridge engineers and the Product Owner to develop new cool features
  • Participate in planning and estimating to continuously improve the product
  • Perform code reviews and share code with other engineers
  • Provide input and technical direction for backend development
  • Contribute to the migration of our PHP legacy application to the new Laravel app (ETA 1 year)
  • Wrote and update technical documentation
  • Participate in bootcamps in Italy and around the world where you can finally meet "in person" your colleagues, exchange ideas and thoughts, do team-building activities and together contribute to creating a better LeadsBridge.

Qualifications and Skills

  • More than 4 years of experience working as a backend developer
  • Strong knowledge of Laravel framework
  • Strong knowledge of Vanilla PHP and Object-Oriented Programming
  • Familiarity with REST/SOAP API
  • Proficient with Git
  • Fluent Italian
  • Highly proficient in spoken and written English
  • Driven to continue learning and exploring
  • Open-minded and passionate about solving problems

How to Stand Out 

  • Familiarity with PHPUnit or Pest
  • Familiarity with other PHP popular frameworks (Symfony, Yii, etc.)
  • Experience with AWS (S3, Dynamo, SQS, etc.)
  • Within 2 hours of Central European Time

Benefits and Perks

  • Work remotely → live and work wherever you like. Remote: 
  • Vacation → at least 4 weeks/year
  • Career Path→ if you are looking for a transparent, growing career, LeadsBridge is the right choice!
  • Retreats → meet your colleagues twice per year! Our next retreat camp will be in Sep/2022 in…
  • Monthly benefit → $150/mo that you can spend for working appliances, gym, training (or any wellness activities), buy books/courses and cover connectivity costs.

LeadsBridge (now an ActiveProspect business)  is an Equal Opportunity Employer.

As a part of being an equal opportunity employer, we are passionate about working with talented and empathetic people. As such, we want you to bring your authentic self to work every single day. We accept you for who you are and consider everyone on an equal opportunity basis.

 

See more jobs at ActiveProspect, Inc.

Apply for this job

+30d

Ruby On Rails Developer

agilelaravelDesignhtml5scrumgitrubyjavacsslinuxjavascriptNode.js

Koombea Inc is hiring a Remote Ruby On Rails Developer

Remote, Latam  |  Full Time  |  2+ years experience  |  English (B2)  |  Competitive Salary

Why Apply to Koombea?

Did you know that Koombea started out as a Ruby on Rails development company? To us, Ruby on Rails isn’t just a framework. We think of it as one of the most powerful technologies available to build digital products. 

By joining our team as a RoR developer, you will not only receive amazing benefits and become part of a flexible and innovative work culture. You will get to share directly with the Rails community worldwide. We have numerous RoR awards and recognitions in different international competitions.

The Job

Your main goals will be: building application models and coding the logic behind the user-facing components and the database of web apps. You will be asked to focus on the performance, usability, accessibility, and adaptability of the apps.

 

What You’ll Do

  • Designing and developing new web applications.
  • Writing and maintaining reliable Ruby code.
  • Identifying and fixing bottlenecks and bugs.
  • Connecting applications with additional web services.
  • Developing and maintaining APIs.
  • Integrate user-facing and server-side components.
  • Build reusable code and libraries for future use.
  • Optimize app performance for speed and scalability.
  • Implement security and data protection measures.
  • Design and implement data storage solutions.
  • Review, refactor and maintain codebases.
  • Deploy web apps to staging and production.

 

What You'll Bring to the Team

  • Ability to write clean ruby code l Must Have
  • Familiarity with MVC, Mocking, RESTful, and ORM l Must Have
  • Experience working with ruby on rails as well as libraries like Sidekiq and RSpec l Must Have
  • Good understanding of front-end technologies including HTML5, JavaScript, and CSS3 l Must Have
  • A desire to stay updated with best practices and conventionsL l Must Have
  • An Agile and Scrum mentality l Must Have
  • Experience with HTML, CSS, and JavaScript l Must Have
  • Testing capabilities l Must Have
  • Good understanding of Linux command line l Must Have
  • Code versioning (Git) l Must Have
  • English proficiency (B2) l Must Have
  • Back-end languages or frameworks like Node.js and Laravel l Nice to Have

 

We Offer You

  • Flexible Working Schedule
  • Health Insurance
  • Remote Work
  • Competitive Compensation
  • Performance Bonuses
  • Surprise Goodies

+ Many Cool Benefits

 

About Koombea

Koombea is an international app development company founded in 2007. We've built hundreds of apps. Some of them have been acquired by companies like Google, Motorola Solutions, Demandforce, Facebook, and Skype.

 

Life at Koombea

If you are looking for a fun and international environment where you can interact with super-smart people, this is the right place for you. 

Join our company and enjoy a healthy work-life balance where flexibility is vital. You will be able to manage your schedule and your career so that you make the most out of your experience at Koombea.

 

Hiring Process

1. Apply

Send us your CV and our team of recruiters will evaluate it.

2. Interviews

Key team members will invite you to meetings to get to know you better.

3. Coding Test

You’ll get to show off your technical skills.

4. Decision

We will let you know if there is a strong fit.

 

Do you have any questions? 

We’d love to hear from you. 

Feel free to contact us atrecruiting@koombea.com

 

Related Jobs

  1. Ruby On Rails Tech Lead
  2. Java Technical Lead

 

Not ready to apply?

Follow us, join our community and stay in the loop.

Position Highlights

  • Remote, Latam
  • 2+ years experience

 

#Li-remote

 

See more jobs at Koombea Inc

Apply for this job

+30d

Programmer / Full Time / Remote Position / Marketing Technology SaaS

MarketerRemote job, Remote
4 years of experiencenosqllaravelDesignjqueryhtml5symfonymysqlcssangularjavascriptPHP

Marketer is hiring a Remote Programmer / Full Time / Remote Position / Marketing Technology SaaS

:: About Us

Inc. Magazine has twice ranked our Company as one of the fastest-growing companies in the United States - and we aren’t done growing!

That’s where you come in...

We’re looking for new team members who are talented, driven, and passionate to join us in making a difference in today’s market.

Our Company strives to deliver impact through (1) innovative, easy-to-use marketing automation software, (2) proven strategies to empower businesses to start up or scale up their dream, and (3) best-in-class support that scales with our customers. Even after 10 years of developing over 12 software platforms, building a private coaching program to train thousands of marketing leaders, and supporting tens of thousands of businesses … there is still so much we want to accomplish!

So if you are looking to join other high achievers in an exciting, long-term opportunity with a global impact, then we have the perfect position for you! More importantly, if you want to expand your talents and experience the challenge of a high-growth environment, then I invite you to keep reading.

:: About the role

This is a rare chance to join a highly successful, high-growth enterprise that is building an empire. As a member of the engineering team, your key focus will be to build and maintain a robust feature set while integrating new technologies into our existing Enterprise level platforms.

The right candidate will take ownership of the services, using their expertise to suggest improvements and help formulate the long-term product roadmap.

This position offers a tremendous amount of growth, allowing you to expand as a contributing engineer on up to 12 applications in our suite of tools. All of which offer different opportunities and challenges to solve for the right individual.


:: You Will -

# Work with product managers, technical leads, and other engineers to design, develop, launch, and operate market-leading Marketing platforms

# Use your experience to collaboratively help integrate our applications

# Collaborate closely with both your senior leads and related engineers - promoting a shared understanding of how to solve common problems and provide solutions


See more jobs at Marketer

Apply for this job

+30d

Laravel Developer

IntiveoVancouver, BC Remote
remote-firstlaravelscrummysqlAWSjavascriptbackendPHP

Intiveo is hiring a Remote Laravel Developer

Laravel Developer

Hello! ????
We need a Laravel Developer to join our Product Development team and grow our product to meet the needs of our customers.
This role reports to our Product Development Lead and also works closely with our Product Management team to efficiently build and deploy industry-leading technology.

Who We Are
Intiveo is a popular patient communication SaaS product used by 14,000 medical practitioners to communicate with over 18 million patients.
We are a remote-first company and we do it well!
Our goal is to continuously improve patient care by understanding communication needs, behaviours, and preferences.

✨What You’ll Do

  • You will work within our product development scrum team to groom, plan, and deliver high-quality product to our customers
  • You will code with our Laravel codebases and communicate with your teammates to find efficient solutions
  • You will collaboratively brainstorm to the improvement of our existing product and creation of new product modules
  • You will architect backend processes to solve complex workflows
  • You will learn and acquire new skills, broaden your existing skills, and contribute to others through knowledge sharing

✨Who You Are

  • You live in Canada ????
  • You have at least 2 year of development experience with the Laravel PHP framework
  • You stay up-to-date on the latest trends and best practices in Laravel development
  • You are passionate about solving problems with the ability to see from the user’s experience
  • You have experience interacting with APIs, MySQL, and Redis

✨Bonus Experiences

  • Exposure with common AWS services
  • HTML, Bootstrap, CSS/SASS and JavaScript experience

More About Intiveo

At Intiveo, we are committed to creating a culture that is inclusive and welcoming of different perspectives, life experiences, cultures and identities. We believe that our differences make us stronger and that many unique perspectives, experiences and backgrounds make for better ideas and more well rounded decisions. Simply put, we love our diversity!

Want to see more? Check out our Culture Book here!


    See more jobs at Intiveo

    Apply for this job

    +30d

    Backend Laravel PHP Web Engineer

    Blue Ocean IdeasTowson, MD Remote
    tailwindlaravelgitmysqltypescriptcsskubernetesbackendfrontendPHP

    Blue Ocean Ideas is hiring a Remote Backend Laravel PHP Web Engineer

    We're looking for someone with very strong back-end skills who is an expert in Laravel. You will be working on a recently launched large association management platform built from the ground up with modern techniques in Laravel.

    About You

    You're a strong problem solver who loves to learn — we're not experts in everything and we don't expect you to be either.

    You are passionate about building great software. Quality is very important to you. You understand the value of testing: unit tests, integration tests, performance tests, etc.

    We don't care if you went to school, we just care about what you can do and how you do it. We're all just makers and tinkerers, so as long as you love to build awesome stuff you'll fit right in.

    What you’ll need

    • Strong experience building complex applications with Laravel.
    • Experience writing tests and using PHPUnit.
    • Strong experience with Git and working with a team using code version control.
    • You've worked on large-scale web applications.
    • Knowledge of React is a plus.

    Our Technology Stack

    • Backend
      • PHP
      • Laravel
      • MySQL
      • Redis
      • Algolia
      • Pusher
    • Frontend
      • React / Intertia.js / TypeScript
      • Tailwind CSS
      • Blade
    • Devops:
      • Octane
      • Kubernetes
      • FluxCD

    About Us

    Blue Ocean Ideas solves problems with Truth, Goodness, and Beauty. We’re building the next generation of Association Management Software. We look for team members exhibiting our virtues, core competencies, and role competencies in their domain.

    Our Virtues

    • Wisdom – Knowing how to act in any situation
    • Fortitude – Showing strength and courage
    • Temperance – Exhibiting moderation
    • Justice – Treating everyone equitably
    • Faith – Believing in the best of people and situations
    • Hope – Seeing a bright future and moving toward that future
    • Love – Acting for the benefit of others

    Our Core Competencies

    • Simplify: Things should be made as simple as possible, but no simpler
    • Organize: Things are in order consistently
    • Anticipate: Sees the future and adjusts accordingly
    • Communicate: Clear, forthright, open, honest

    Benefits

    • 401k
    • Flexible time off policy
    • Health insurance (HSA with compatible plans)
    • Dental insurance
    • Vision insurance
    • Life insurance
    • Long-term disability insurance
    • Apple MacBook Pro + second screen

    See more jobs at Blue Ocean Ideas

    Apply for this job

    +30d

    Engineering Lead

    Firstbase.ioSão Paulo or Remote
    agile3 years of experiencefigmalaravelDesignvueslackapiqasymfonydockerpostgresqlAWSbackendfrontendPHP

    Firstbase.io is hiring a Remote Engineering Lead

    Engineering Lead at Firstbase.io (W21)
    All in one Company OS
    São Paulo or Remote / Remote
    Full-time
    3+ years
    About Firstbase.io

    Firstbase is building an all-in-one Company OS to help define how founders across the globe launch, manage and grow their businesses. More than ten thousand founders from over a hundred countries have used our product, Firstbase Start, to launch their startup. For many founders, "firstbase.io" has become what they type into their address bars when they think about incorporating a business.

    About the role

    Skills: Vue.js, PHP

    About the role

    Firstbase.io is hiring an Engineering Lead to work in tandem with the Product Managers, Engineers and Designers to shape the future of Firstbase’s products. You’ll thrive in this role if you have experience building relationships with and influencing cross-functional team members, delivering high quality projects on time, and analyzing data to produce actionable recommendations.

    Top candidates for this position will have a natural desire to continuously improve the product, enormous user empathy, and can maintain a calm demeanor in high stress situations. People describe our ideal Engineering Lead as accountable, organized, and customer obsessed.

    What's Firstbase.io

    Firstbase is building an all-in-one Company OS to help define how founders across the globe launch, manage, and grow their businesses.

    More than ten thousand founders from over a hundred countries have used our incorporation product, Firstbase Start, to launch their startup. For many founders, "firstbase.io" has become what they type into their address bars when they think about incorporating a business. 

    We are backed by Y Combinator & our team, investors, and advisors include people from Apple, Gusto, Carta, Wise, Plaid, and many other great companies.

    Why you should join

    Firstbase is much more than just incorporation. Our team is dedicated to building products & solving some of the startups’ hardest problems, with a particular focus in:

    • Democratizing access to financial infrastructure
    • Automating tasks every founder faces when running a business
    • Making tools and resources more accessible to everyone, everywhere
    • Building integrated solutions for founders and removing friction
    • Delivering opportunities to traditionally overlooked founders and companies
    • Democratizing access to knowledge

    Join us on a mission to help more companies succeed!

    Who are we looking for

    We are looking for risk-takers with diverse experience able to provide fearless feedback.

    You will have the following duties

    • Experience in growing and leading software engineering teams, managing developers and mentoring them
    • Experience leading end to end software development, from requirements, through architecture, development, testing, delivery and all associated processes
    • Experience working on complex software systems involving both Cloud/SaaS and On-Prem, in microservices architectures
    • Knowledge of agile development processes and best practices, and demonstrated experience assimilating those to achieve streamlined execution
    • Ability and desire to span from high-level concepts to low-level details of implementation
    • Versed in a wide variety of user facing and back-end technologies and architecture

    You should meet the following requirements

    • At least 3 years of experience leading software development teams
    • BSc in computer science, electrical engineering or equivalent
    • Startup experience, building production systems from an early stage
    • Experience working on products sold to enterprise customers
    • Familiarity with concepts of IT environments and complex integrations
    • Experience with PHP, Symfony, Vue and its ecosystem
    • Hands-on experience with modern Frontend and Backend technologies
    • Experience working on products involving machine and deep learning
    • Experience dealing with time series data
    • Understanding control systems

    Some perks you might enjoy

    • Competitive salary and equity: We lean on some of the best market data to ensure that we offer the most competitive compensation.

    • Hybrid work environment: We work both remotely & from our offices in New York City in São Paulo – optimizing for collaboration while providing flexibility to team members.

    • 21 days of PTO + birthday off: We offer flexibility to allow people to relax and recharge whenever they need it.

    • Build your ideal work setup: We understand that how you work is extremely important, so we provide a stipend to set yourself up for success here at Firstbase.

    • Health benefits: Firstbase offers health insurance reimbursements to both US and international employees.

    • Learning and development: We provide a stipend together with resources to help people grow and develop in their careers.

    • Amazing quarterly bonus: Every team at Firstbase has a bonus structure that usually accounts for 20-25% of OTE.

    The stack

    Our product is built using PHP, Symfony, Vue ,PostgreSQL, AWS. We also use Redis, Vue Router, Vuex, Docker Compose, Docker, GitLab CI, and Graylog, and some third-party API's like Stripe. We use Slack, Clubhouse, Notion, Whimsical, Figma, and G Suite to collaborate and build together.

    Technology

    Current back-end tech stack:

    PHP Laravel PostgreSQL Docker (Compose and Swarm) GitLab CI AWS S3 AWS EC2 GreyLog

    Current front-end tech stack:

    Vue (and Vue-Router) Vuex 3rd party libs for GTM/Stripe/etc.

    Apply Now

    See more jobs at Firstbase.io

    Apply for this job

    +30d

    Senior Developer (PHP)

    IQ EQ3 More London Riverside, 3 More London Riverside, London SE1 2RE, UK, Remote
    agilejiranosqlRabbitMQlaravelapisymfonybackendPHP

    IQ EQ is hiring a Remote Senior Developer (PHP)

    Company Description

    Do you want to be part of a Global Private Equity Administrator who provides outsourced Administration services for PE, Real Estate, Depository and Compliance with Assets under Administration in the excess of $650Billion? If so, please read on!

    With offices across 23 jurisdictions including New York, London, Paris, Amsterdam, Cayman, BVI, Belfast, Dublin, Guernsey, Jersey, Luxembourg, Netherlands, Cyprus, Mauritius, Singapore, Hong Kong and Manila our growth journey has only just begun. 

    Job Description

    As our key Senior Developer you will report directly to our Head of R&D. You will be working on the continuous development of the proprietary RegTech software solution, MaxComply, in an Agile environment. You will be largely working on a LAMP based technology stack using the PHP framework Symfony 5.4 and above, for developing the backend microservices.

    Key Responsibilities:

    • Work as part of a dynamic development team on the forefront of PHP application development
    • Contributing to the continuing development of the software architecture of MaxComply
    • Finding code solutions to business process specifications by programming new software modules, with exposure to the full technology stack
    • Resolving bug fix tickets on the internally developed code base
    • Liaising with superusers to identify and specify business requirements for new features
    • Show an awareness of ongoing security risks and solutions
    • Write well-structured, clean, and efficient code, in line with OOP SOLID principles

    Qualifications

    • 3-5 years commercial software development experience in PHP
    • At least 3 years’ experience in one of the modern PHP frameworks (experience with Symfony or Laravel is a plus)
    • At least 2 years’ experience in the Agile/Scrum development methodology
    • Understanding of microservice approach to application development
    • Understanding of OOP SOLID principles
    • Good understanding of designing robust REST API
    • Experience writing automated unit tests
    • Experience working with relational databases
    • Knowledge of NoSQL databases is a plus
    • Experience with queueing systems (RabbitMQ) is a plus
    • Experience with caching systems is a plus
    • Exposure to IDE environments and Continuous Integration tools (Bitbucket, Jira etc)
    • An understanding of financial compliance processes is not necessary, but a willingness to learn and understand business workflows is essential
    • Excellent verbal and oral communication skills 
    • Enthusiasm to grow and learn from experienced colleagues
    • Process oriented working style with clear goal direction and output focus

    Additional Information

    At IQ-EQ we want you to reach your full potential. We offer an inclusive and diverse environment to support your career aspirations. With a strong emphasis on continuous learning and a holistic approach to your professional and personal development. We also offer opportunities across our service lines and our international network of offices.

    If you are looking for a role where you will be given the opportunity to bring fresh ideas, drive forward improvements with a willingness to learn, develop and keep abreast of technological developments, we would love to hear from you!

    If you would like to take on this exciting challenge, please apply today for immediate consideration.

    See more jobs at IQ EQ

    Apply for this job

    +30d

    Director Product Marketing

    QuartzyRemote
    B2BlaravelDesignelasticsearchmysqlAWSPHP

    Quartzy is hiring a Remote Director Product Marketing

    Director Product Marketing at Quartzy (S11)
    Marketplace for life science supplies.
    Remote
    Full-time
    6+ years
    About Quartzy

    Quartzy is the world’s #1 lab management platform. Every day, hundreds of thousands of scientists from all over the world improve the efficiency of their research by using Quartzy. Our team is passionate about accelerating scientific research through well-designed, meaningful tools for academic and industry labs alike.

    About the role

    Quartzy is seeking a Director of Product Marketing for our rapidly growing SaaS business it’s an exciting time to join Quartzy, which has achieved product-market-fit and is now investing heavily in our SaaS product and our sales and marketing departments.

    Why Quartzy Quartzy fills a critical need in the life science market, as the gold standard lab operations platform. Every day, hundreds of thousands of scientists from all over the world ensure they have what they need to do their experiments using Quartzy. Our software combines lab resource management software and eCommerce, producing unique value in this large market, returning time to researchers who can focus on their next discoveries. Our customers range from wine makers, to food/ag companies, to companies working on COVID testing and therapies. We are humbled every day to serve them.

    About You This is a high-level individual contributor role. You will report to a founder and have considerable independence in shaping our strategy and executing(with the help of our marketing team and agencies) to bring our products to market. You will own marketing strategies and initiatives that increase our market share by communicating the value our platform offers to prospects, customers, and the market at large.

    Quartzy has a 100% distributed team so this role can be done anywhere in the US.

    What You'll Do Develop product positioning and messaging that resonates with our target buyer personas. Market & Persona Intelligence—Be the expert on our customers and the market we play-in. Know who the decision makers and their influencers are and what the customer landscape looks like Define and articulate our go-to-market strategy for product releases Understand the competitive landscape—be an expert on our competition and how they are positioned. Develop comparison content for sales Plan the launches of new product features, and manage the cross-functional implementation of the launch plan

    What We're Looking For Bachelor’s degree in business or marketing; MBA preferred 6-10 years of product marketing experience in B2B SaaS Strong analytical skills - Comfortable using business intelligence and CRM tools such as Looker and Salesforce. You enjoy asking questions and answering them with data. Familiar with marketing automation tools - Hubspot, and Google Analytics Exceptional ROI-tracking skills, able to prove what is–or isn’t—working Excellent people skills. You can fluidly interact with staff, colleagues, cross-functional teams and third parties to drive projects forward. Team player! Strong public speaker

    What We Offer Great Insurance - we cover 100% of employee premium cost and 50% for partner/family Great Culture -participate in our fun events like ActiviTuesday, Wellness Wednesdays, happy hours & speaker series Remote Team - we’re 100% distributed so you can live anywhere in the US! Transparency - weekly all company stand ups, monthly town halls, quarterly state of the start ups and anytime access to co-founders Generous Time Off -take the time you need, when you need it Great Gear - we’ll set you up for success with the latest tech and help you outfit your home office. And, a free Spotify premium account!

    Does this sound like you? We'd love to hear from you.

    Technology

    • React
    • Laravel
    • PHP
    • MySQL
    • Elasticsearch
    • AWS
    • Ember.js

    See more jobs at Quartzy

    Apply for this job

    +30d

    Diablo/Freud Tools Full Stack Software Developer (Hybrid Remote)

    Bosch Group51 Armour Dr NE, Atlanta, GA 30324, USA, Remote
    agileBachelor's degreenosqllaravelmetalhtml5apimysqlcsslinuxjavascriptbackendfrontendPHP

    Bosch Group is hiring a Remote Diablo/Freud Tools Full Stack Software Developer (Hybrid Remote)

    Company Description

    CHANGING THE MARKET FOREVER

    At Diablo/Freud Tools, we know that every career matters which is why you should conduct yours on a grand scale. As the industry-leading manufacturer of premium cutting tools and power tool accessories, we offer premium solutions through our two main divisions: Freud Tools (www.freudtools.com)  for the woodworker and operator and Diablo Tools (www.diablotools.com). for the professional construction, remodeler, and tradesman.

    Diablo/Freud Tools is the only manufacturer of woodworking tools in the world that produces its own MicroGrain Carbide with titanium, called TiCo™, a high-density combination of titanium and cobalt. By producing their own carbide, Diablo/Freud Tools has the unique ability to formulate each tool for each specific application, thereby maximizing the cutting life and performance of the tool. Diablo/Freud Tool’s full line of high-quality of wood, metal and concrete cutting tools and power tool accessories includes saw blades, router bits, shaper cutters, hammer drill bits, sandpaper, hole saws, reciprocating blades and much more.

    Diablo/Freud Toolsis headquartered in High Point, NC and is the home of our North American Distribution Center as well as most corporate functions. Sales and marketing are headquartered in Atlanta, GA.

    Diablo/Freud Tools is a division of the Robert Bosch Tool Corporation and is guided by the principles of founder Robert Bosch. We are an integral part of a multinational engineering and electronics organization and the largest privately held employer in the world. We offer a setting where social and environmental responsibility are part of our corporate DNA. Always mindful of our impact on the future, we are committed to sustainability, paying it forward, giving back, and lifelong learning. These are but a few of the reasons why our parent company has more than 400,000 associates and a legacy of success spanning 135+ years.

    • This is your chance to Go big. Go bold. And use your skills to drive success on a massive scale, with Diablo/Freud Tools:*

    GO DIABLO/FREUD TOOLS, AND EXPERIENCE BIG REWARDS.

    Diablo/Freud Tools offers the competitive compensation, career-development resources, and benefits you would expect of a world leader, including health, medical, and financial plans; work/life balance; and flexible work options.

    Equal Opportunity Employer

    With more than 400,000 associates in a variety of locations, including 60 countries worldwide, diversity and inclusion (D&I) is a lived experience at Robert Bosch Tool Corporation.

    Job Description

    The Full Stack Software Developer will assist an in-house software engineering team in developing next generation web based applications using the latest technologies. The ideal candidate enjoys solving problems and creating world class solutions. Someone who takes pride in the robustness and quality of their work at every stage of the development process and is equally comfortable working on backend and frontend code. This individual is highly motivated, can take ownership of projects and features; and is able to work independently as part of an agile software development team.

    PRIMARY DUTIES INCLUDE

    • Building new features for internal and external web based application across the backend and frontend using PHP and JavaScript
    • Optimizing code for maintainability, scalability, and security
    • Implementing user experience improvements using HTML, CSS, and JavaScript
    • Refactoring sections of the code base to comply with best practices in software engineering principles.
    • Thoroughly test and document all code produced and assist in integration testing of code across all platforms.
    • Assist in API documentation, versioning and testing.

    Qualifications

    • Bachelor's Degree in Computer Science, Information Systems, Engineering, or a scientific or technical disciple and 2+ years of experience; or have 8 years of commensurate experience in lieu of degree. 
    • Experience and fluency with PHP 7.x, Javascript (ES6), MySQL * NoSQL databases, HTML5 CSS/SCSS, RESTful API development, GIT.
    • Additional consideration given to experience and fluency with Laravel PHP framework and Vue.js Javascript framework, Composer package manager, NPM, Webpack.
    • Additional consideration given to experience with Linux operating system, cloud server architectures, DevOps development practices, build & deployment systems, API integrations and data transformations, server-side scripting.

    Additional Information

    Diablo/Freud Tools and the Robert Bosch Tool Corporation are proud supporters of STEM (Science, Technology, Engineering & Mathematics) Initiatives

    ·       FIRST Robotics (For Inspiration and Recognition of Science and Technology)

    ·       AWIM (A World In Motion)

    By choice, we are committed to a diverse workforce – EOE/Protected Veteran/Disabled.

    Indefinite U.S. Work authorized individuals only.  Future sponsorship for work authorization unavailable.

    See more jobs at Bosch Group

    Apply for this job

    +30d

    Senior Full Stack Software Engineer

    Prompt Therapy SolutionsParamus, NJ Remote
    postgreslaravelDesignrubymysqlangularNode.jsPHP

    Prompt Therapy Solutions is hiring a Remote Senior Full Stack Software Engineer

    Engineering at Prompt

    Prompt continues to disrupt the healthcare and medical billing industry by delivering innovative, technology-driven solutions. Our talented engineering team is dogma free and results driven. We are relentless in our drive to reliably deliver outstanding products at scale. We are growing fast, but we can go further, faster with experienced, collaborative, challenge-seeking engineers like yourself.

    As a Senior Software Engineer you will be a foundational piece to the growth of the product, team, and strategy at Prompt Therapy Solutions Inc. You will be one of the leaders in our development process driving concepts from ideation all the way to creation. Encourage the growth of our engineering team's strategy with your wisdom and experience in the industry. Help shape the engineering team by establishing best practices and hand picking the best talents on the market.

    At Prompt, Software Engineers are the keystones of our industry leading product and are the main reason we can deliver a high quality software that improves the lives of our customers each and every day.

    Responsibilities

    • Influence Engineering team strategy and product architecture
    • Create technical specifications for up and coming features
    • Oversee engineering grooming sessions and delegate feature development estimations
    • Mentor up and coming engineers
    • Develop new features for the Product
    • Participate and contribute to the Code Review process
    • Engage in Design Reviews, Product Retrospectives, and other team based ceremonies
    • Conduct technical interviews with candidates to help build the Prompt Team

    Qualifications

    • 5+ years of experience of software development experience with a focus on Full Stack web development
    • Strong communication skills and the ability to comfortably articulate you thoughts and decisions
    • Desire to contribute to the growth of the product, team, and direction of Prompt Therapy Solutions Inc.
    • A working knowledge of the technologies listed below

    Technology

    The ecosystem you will be working in.

    • Please have a working knowledge of PHP, Laravel, Vue.JS, and MySQL or any equivalent (Ruby, Node.JS, React, Angular, Ember, Postgres, MSSQL, etc.)

    • Please only apply if you are interested in a heavy code contribution role as we are not looking for engineering managers

    Perks

    What you can expect.

    • Competitive salaries
    • Equity compensation in the form of stock options.
    • 401k
    • Health Insurance Benefits
    • Generous PTO
    • Bi-Weekly company wide sponsored lunches'

    Culture

    Why work for Prompt?

    • BIG Challenges:
      Here at Prompt, we are solving complex and unique problems that have plagued the healthcare industry since the dawn of time.
    • Talented People:
      Prompt didn't happen by chance, it's a team of incredibly talented and proven individuals who all made their mark before joining forces to build the greatest software on the planet for physical, occupational, and speech therapists.
    • Healthy Approach:
      This isn't an investment bank, we work long hours when it's needed, but at Prompt you own your workload and the entire organization takes a liking to smart work (over hard work).
    • Environmentally Friendly:
      We are converting medical practices around the country into paperless operations. We aren't enthralled with patting ourselves on the back everyday, but it does feel good :)

    FAQ’s

    You might want to know…

    • Do I have to come to an office to do a job that is accomplished on a computer?
      No. This is a 100% remote position. Wear sweatpants, put your feet up, listen to Kanye, whatever you fancy is what you can enjoy in the comfort of your own home. If we have an office close by, we do love to get the team together when it makes sense.
    • Will I be working under a non-technical, slightly irritating "product manager"?
      No. Prompt has a flat management style and the only people you are working with are highly skilled and proven engineers.
    • Do I have to install a time tracker on my computer because you do not trust my work ethic?
      No. Prompt employees work around U.S. business hours in order to promote clear communication. You’d be expected to do the same within reason (and without time trackers). We are flexible and prioritize actual output over how long something took.
    • Will I be working on tedious projects that never make it to production?
      No. We don't have time to waste, your work in the first month here will be in the product, we 100% guarantee it.
    • Will the hiring process be dragged out?
      No. You will hear back quickly and we have a two day interviewing process, with both days being within a week of each other (or at your convenience). We know you are busy.
    • Is Prompt growing quickly?
      YES! Prompt grew 1600% in 2020 and we are on track to grow exponentially again this year.

    See more jobs at Prompt Therapy Solutions

    Apply for this job

    +30d

    Permanent Job: Full Stack PHP Developer with Laravel - Remote

    BeyPark St, Jersey City, NJ 07304, USA, Remote
    tailwindlaravelvuesassiosgitandroiddockermysqlcsslinuxangularAWSjavascriptfrontendPHP

    Bey is hiring a Remote Permanent Job: Full Stack PHP Developer with Laravel - Remote

    Job Description

    Title: Full Stack PHP Developer

    Type: Fulltime

    Location: Remote

    Salary Range: DOE

    The Role:Client is looking to add a remote developer to its team to help us increase our ability to deliver more projects quickly while retaining the ability to maintain the website and improve site performance.

    Minimum 4 years’ experience with: PHP 7.x, Developing applications with Laravel, Working with a frontend JavaScript framework, Working knowledge of Git / GitHub, MySQL,

    Preferred experience in:Vue JS, Angular, Elastic Search & Algolia, Sass, Webpack / Gulp

    Bonus points:Tailwind CSS, Test-driven development, GitHub Actions, React Native, iOS / Android app development experience, Contributions to Open Source, Docker, Basic DevOps knowledge (AWS, Linux, Nginx)

    Additional Information

    All your information will be kept confidential according to EEO guidelines.

    See more jobs at Bey

    Apply for this job

    +30d

    Senior Backend/Fullstack Developer (PHP)

    CoveSingapore Remote
    Bachelor's degree3 years of experiencewordpresstailwindlaravelDesignapigitmysqlcsslinuxfrontendPHP

    Cove is hiring a Remote Senior Backend/Fullstack Developer (PHP)

    About Cove: Cove is the new way to rent your home! We’re a co-living start-up making it easier and more affordable for people to rent rooms. We provide our tenants with stylishly furnished properties, in the most awesome locations in Singapore and Jakarta and make the whole rental process seamless from end to end. Our contract terms are flexible like our tenants’ lives and our rental prices include everything from utilities and wifi and weekly cleaning. Our tenants get matched with great flatmates and also have access to our community events around the city. Check us out at cove.sg or cove.id.

    Job Title: Senior Backend/Fullstack Developer (PHP)

    Job Type: Permanent (Open to a remote position nearby GMT+8)

    Start Date: ASAP

    Reports To: Head of Engineering

    Role Purpose:This role will support web development initiatives in the Company. We're open to having applications that can work equal to SGT (GMT+08).

    Responsibilities:

    • Develop and maintain current and legacy backends (Laravel, WordPress)
    • Collaborate with other Tech team members to design and develop products
    • Work with external APIs, build and maintain integrations
    • Produce clean and maintainable code

      Requirements:

      • Bachelor's Degree in Computer Science/math
      • 3 years of experience in PHP (PHP 7, Laravel/Symfony)
      • SOLID/KISS/DRY
      • MySQL, Redis
      • Experience in building REST API
        • Unit testing
        • CI/CD, Linux, nginx, git
        • Have systemic thinking, proactivity, ability to work independently, following best practices, curiosity, and desire to constantly learn

        Nice to have:

        • Laravel
        • Experience in Frontend (React.js, Next.js, Tailwind CSS)
        • WordPress

        What’s in it for You:

        Working for Cove gives you the opportunity to join an exciting young start-up incubated through Antler.co. In your role, you’ll have the opportunity to hit the ground running and take ownership from day one. We will always welcome your input and ideas and actively encourage your development. The team is fast-paced, hard-working, and expects results but we also highly value our employee engagement and are committed to a human and empathetic environment with plenty of fun thrown in.

        See more jobs at Cove

        Apply for this job