laravel Remote Jobs

31 Results

4d

DevOps Engineer

ClaravineRemote, Utah, United States
1 year of experiencekotlinterraformlaravelmobileqamysqltypescriptkubernetesAWSPHP

Claravine is hiring a Remote DevOps Engineer

Who we are

At Claravine we help large organizations solve difficult data consistency and accuracy problems, often within their marketing groups. We do this through a web SaaS product that enables customers to set their own data standards and provides a way for their teams to validate their data.

This may be your first time hearing about Claravine, but you have definitely seen ads that used Claravine as part of their creation. Claravine helps several Fortune 500 companies that operate on a global scale.

About Us

We are a team of people who solve difficult problems through web SaaS, which is why we are more interested in smart problem-solvers than experts with specific languages or frameworks. We work in small cross-functional teams that are truly empowered to make a large impact on the entire company.

We work with a lot of data and integrate with other platforms. We currently accomplish this through a tech stack of Kotlin (Spring), PHP (Laravel), React, Node (Typescript), MySQL, AWS, Kubernetes, and remote development environments.


What You Will Do

  • Bring up your ideas to help us improve
  • Recharge when you need it, not only when you have enough PTO accrued
  • Solve complex technical problems through creative solutions
  • Directly impact the entire SaaS company through your contributions
  • Wear multiple hats and own part of a startup (e.g., code, testing, deployments, etc.)

Job Requirements

  • You live within 4 hours time zone of Mountain Standard Time (UTC-7)
  • You are looking for full-time (no time-bound contracts, part-time hours, etc.)
  • You are fluent in English for both speaking and writing
  • You have professional experience running applications in the cloud
  • You are interested in working with several different technologies
  • You like communicating with others
  • You can work on problems without being given instructions for each step

Our Ideal Candidate

  • Has 2+ years of experience with core AWS services (RDS, EKS, S3, IAM)
  • Has 2+ years of experience with Version Control managed CI/CD configuration (CircleCI, Gitlab, Github Actions, etc.)
  • Has at least 1 year of experience working with Kubernetes
  • Has at least 1 year of experience with Infrastructure as Code tools (Terraform preferred)
  • Has experience with infrastructure & service monitoring
  • Has familiarity with the concepts of CDNs and data geo-replication
  • Has experience running SOC 2 compliant infrastructure
  • Has an interest in wearing multiple hats (e.g., potentially writing some code, assisting with QA automation, etc.)


What We Offer You


  • A virtual-first, distributed team model; this role can be performed remotely or in-person from our office in Lehi, Utah
  • Opportunity to be a central player in building a high performance partner program
  • Upwardly-mobile role in a fast-growing enterprise SaaS company
  • Competitive salary and compensation
  • Health, dental and vision benefits package, and 401(k) matching program
  • Family leave program (Maternity, Paternity) and unlimited PTO
  • Regularly planned team outings and company events
  • Investment in the tools and technologies you need to succeed 
  • Opportunity to work with a fun, collaborative, values-driven team


Our Recruiting Process

  • Intro with recruitment
  • Meet the Director of Engineering
  • Technical and cultural interview with the Engineering team


Starting Salary Range: $105,000 - $115,000


Claravine believes in equal opportunity for all. All applicants will receive equal consideration for employment without regard to race, ethnicity, national origin, religion, sexual orientation, gender identity, disability, or protected veteran status. No agency, please.

See more jobs at Claravine

Apply for this job

13d

Full Stack Software Engineer

LiteraRemote, United Kingdom
agilejirasqllaravelDesignscrumqagitPHP

Litera is hiring a Remote Full Stack Software Engineer

Description

Our Story:Litera is a fast-growing software company and one of the leading legal technology suppliers in the world. Serving more than 90% of the world's largest law firms, our software is used by hundreds of thousands of lawyers every day. As a company recognized as one of the best places to work, we believe professional development, rewards programs, open communication, and transparent leadership all contribute to a unique and open work environment. Our employees are driven, energetic, passionate, and have the ability to make a direct impact on the future of the company.

The Opportunity:Come join a relentless team of software engineers dedicated to helping the legal world collaborate on their strategic goals and identify new business opportunities within their existing clients. You will help grow our development team by participating in the full SDLC (Software Development Lifecycle) from preliminary system analysis to testing and deployment. This hybrid-engineering role includes building high quality and fully performing software that meets quality and software development standards alongside a great group of smart, motivated people, with a focus on customer delight.

A Day in the Life:

  • Take ownership of product features from estimates to design and development
  • Write clean, maintainable code that is extensible with minimum number of defects
  • Refactor and improve existing software
  • Collaborate with cross-functional teams (PM, QA) to complete tasks
  • Manage individual task priorities, deadlines, and deliverables
  • Provide guidance on modern software engineering techniques and methodologies for code reviews
  • Coach and mentor less experienced team members

 

Role progression:

Within 1 month, you will:

  • Complete our Engineering onboarding plan
  • Meet the team and learn the details of our business, as well as where we are headed
  • Familiarize yourself with our Software Development Life Cycle and our specific flavor of Scrum
  • Participate in Scrum ceremonies

Within 3 months, you will:

  • Gain insight into the Department goals, and how they relate to the overall Company vision
  • Develop Personal Objectives in conjunction with your manager which align to the Department’s objectives
  • Start participating in Sprint planning and contributing to Sprint work in your Scrum team

Within 6 months, you will:

  • Contribute, as a fully integrated member of your Scrum team
  • Complete assigned tasks within the given timeframe
  • Write code that is readable, extensible, well commented, and that does not require multiple iterations to correct issues found by QA
  • Require minimal supervision for assigned tasks
  • Assist, guide, advise, and help team members:
    • to complete their assignments within the given timeframe
    • to adhere to processes (code reviews), coding standards, and best practices (technical debt burndown)
    • ensure written code meets quality standards (minimal rejections by QA)
    • identify areas for improvement (performance, readability, stability, etc.) in code for other team members

About You:

Requirements

  • Good knowledge of development using JS/React/CSS at a mid-senior level (4+ years)
  • Good knowledge of development using PHP & Laravel at a mid-senior level (4+ years)
  • Ability to work with legacy PHP & JS code
  • Good understanding of design patterns and OOP concepts
  • Good knowledge of building and extending REST APIs
  • Good knowledge of SQL database design
  • Knowledge of source control with Git, especially branching/merging as needed
  • Familiar with Atlassian products – JIRA
  • Familiarity with agile techniques
  • Experience with unit/integration/acceptance tests

Desirable

  • Experience of CI/CD (DevOps)
  • Experience of Design Systems

Soft Skills

  • Comfortable working in an Agile environment and have a working experience with Agile/Scrum
  • Ability to work independently without instructions on most tasks, but would know when to ask for help
  • Comfortable with recommending which modern software development techniques and methodologies to use
  • Enthusiastic about problem solving, digging into issues, and owning tasks to completion
  • Extensive understanding of software development principles (object-oriented design, SOLID, etc.)
  • Experience delivering solutions that scale

 

What Sets us Apart?

  • Work with a team that has a proven track record
  • Our company growth will challenge, and encourage you to broaden your skills
  • Access to ongoing, online technical training courses
  • Generous allocation of paid time off, and flexible work hours
  • Available merit-based cash bonus plan
  • Access to our Employee Assistance Programme
  • Employer pension contributions
  • Private medical insurance plan

See more jobs at Litera

Apply for this job

14d

Backend Developer (PHP)

CoveSingapore, SG Remote
Bachelor's degree5 years of experiencewordpresstailwindlaravelDesignapigitmysqlcsslinuxbackendfrontendPHP

Cove is hiring a Remote Backend Developer (PHP)

About Cove: Cove is the new way to rent your home! We’re a co-living start-up making it easier and more affordable for young people to have a comfortable place they can call home with a seamless rental experience from end to end. We provide our tenants with stylishly furnished properties, in the most awesome locations in Singapore and Jakarta and make the whole rental process seamless from end to end. Our contract terms are flexible like our tenant’s lives and our rental prices include everything from utilities and wifi and weekly cleaning. What’s unique about Cove is that our tenants get matched with great flatmates and also have access to our community events around the city. Check us out for more exciting information at https://cove.sg.

At Cove we reward and praise strong performance and strive to produce zero-defect results. We always aim for excellence and to always have the mindset of continuous improvement. In achieving results, we still make work fun and we completely value our team as people, not just resources in which we display care as well as empathy. Celebrating success with our team is also our priority and we highly encourage integrity and transparency.

Job Title: Backend/Fullstack Developer (PHP)

Job Type: Permanent (Open to a remote position nearby GMT+8)

Start Date: ASAP

Reports To: Head of Engineering

Role Purpose:This role will support web development initiatives in the Company. We're open to having applications that can work equal to SGT (GMT+08).

Responsibilities:

  • Develop and maintain our Laravel backend and its integration with the Property Management System
  • Work with external APIs, build and maintain other integrations
    • Collaborate with other Tech team members to design and develop products and features
    • Produce clean and maintainable code

      Requirements:

      • Bachelor's Degree in Computer Science/math
      • 5 years of experience in PHP (PHP 7, Laravel/Symfony)
      • SOLID/KISS/DRY
      • MySQL, Redis
      • Experience in designing and building REST API
        • Unit testing
        • CI/CD, Linux, nginx, git
        • Have systemic thinking, proactivity, ability to work independently, following best practices, curiosity, and desire to constantly learn

        Nice to have:

        • Experience in Frontend (React.js, Next.js, Tailwind CSS)
        • WordPress

        What’s in it for You:

        Working for Cove gives you the opportunity to join an exciting young start-up incubated through Antler.co. In your role, you’ll have the opportunity to hit the ground running and take ownership from day one. We will always welcome your input and ideas and actively encourage your development. The team is fast-paced, hard-working, and expects results but we also highly value our employee engagement and are committed to a human and empathetic environment with plenty of fun thrown in.

        See more jobs at Cove

        Apply for this job

        22d

        Backend Laravel PHP Web Engineer

        Blue Ocean IdeasTowson, MD Remote
        tailwindlaravelgitmysqltypescriptcsskubernetesbackendfrontendPHP

        Blue Ocean Ideas is hiring a Remote Backend Laravel PHP Web Engineer

        We're looking for someone with very strong back-end skills who is an expert in Laravel. You will be working on a recently launched large association management platform built from the ground up with modern techniques in Laravel.

        About You

        You're a strong problem solver who loves to learn — we're not experts in everything and we don't expect you to be either.

        You are passionate about building great software. Quality is very important to you. You understand the value of testing: unit tests, integration tests, performance tests, etc.

        We don't care if you went to school, we just care about what you can do and how you do it. We're all just makers and tinkerers, so as long as you love to build awesome stuff you'll fit right in.

        What you’ll need

        • Strong experience building complex applications with Laravel.
        • Experience writing tests and using PHPUnit.
        • Strong experience with Git and working with a team using code version control.
        • You've worked on large-scale web applications.
        • Knowledge of React is a plus.

        Our Technology Stack

        • Backend
          • PHP
          • Laravel
          • MySQL
          • Redis
          • Algolia
          • Pusher
        • Frontend
          • React / Intertia.js / TypeScript
          • Tailwind CSS
          • Blade
        • Devops:
          • Octane
          • Kubernetes
          • FluxCD

        About Us

        Blue Ocean Ideas solves problems with Truth, Goodness, and Beauty. We’re building the next generation of Association Management Software. We look for team members exhibiting our virtues, core competencies, and role competencies in their domain.

        Our Virtues

        • Wisdom – Knowing how to act in any situation
        • Fortitude – Showing strength and courage
        • Temperance – Exhibiting moderation
        • Justice – Treating everyone equitably
        • Faith – Believing in the best of people and situations
        • Hope – Seeing a bright future and moving toward that future
        • Love – Acting for the benefit of others

        Our Core Competencies

        • Simplify: Things should be made as simple as possible, but no simpler
        • Organize: Things are in order consistently
        • Anticipate: Sees the future and adjusts accordingly
        • Communicate: Clear, forthright, open, honest

        Benefits

        • 401k
        • Flexible time off policy
        • Health insurance (HSA with compatible plans)
        • Dental insurance
        • Vision insurance
        • Life insurance
        • Long-term disability insurance
        • Apple MacBook Pro + second screen

        See more jobs at Blue Ocean Ideas

        Apply for this job

        22d

        Ruby On Rails Developer

        agilelaravelDesignscrumgitrubyjavalinuxNode.js

        Koombea Inc is hiring a Remote Ruby On Rails Developer

        Ruby On Rails Developer - Koombea Inc - Career Page
        28d

        Senior Software Engineer (Full Stack)

        GenUISeattle, WA Remote
        jirapostgreslaravelDesignswiftmobilemongodbazureuiapiUXrubyjavac++mysqlpythonjavascriptreactjsPHP

        GenUI is hiring a Remote Senior Software Engineer (Full Stack)

        100% Remote, - US based only

        Employment Type:Contract to Perm, or Contract

        About GenUI:

        GenUI is a Seattle-based, software design and development solution provider. We collaborate with industry and thought leaders to bring innovative software products to life. We believe “the future will be built together and specialize in the latest and greatest cutting edge technology such as Tech Commercialization, Web3, AI/ML, AR/VR, IoT, Spatial Audio, Robotic Automation, Digital Transformation, Modernization, Mobile and Cloud. Our team is a diverse collection of experts in product, mobile, web and cloud solutions.

        GenUI is employee experience focused and rated as one of the 2022 best places to work by the Puget Sound Business Journal (PSBJ) & Glassdoor. As one of Inc's Fastest Growing Private Companies in America, our work has been recognized with Apple's 'Best of the Year', TIME Magazine's 'App of the Week', Gizmodo's 'App of the Day', Sabre's and Red Appy 'Best App', as well as featured in Fortune, Wired, Fast Company, The Washington Post, Bloomberg, and more.

        About the Position:

        Our Software Engineers are designers who love cutting edge technology, and who want their work to have meaning and impact. They collaborate in tightly knit teams to design & develop new software solutions that bring our clients’ projects to life. In this role you will work closely with our internal engineering team developers, as well as directly with our clients to understand project requirements, contribute to the design/architecture, and provided development and testing. For each project you will provide full-stack development, solve a wide range of cloud/server-side problems, and the API, data and services they require in a performant, efficient, and most of all easy-to-use way. This role can be either a contract or a contract to permanent employment position.

        Your Opportunities:

        • Work and learn with teams of experienced engineers, UX designers and product designers
        • Work on cutting edge technologies, products and business solutions that include societal challenges, tech commercialization, Web3, AI/ML, AR/VR, IoT, Spatial Audio, Robotic Automation, Digital Transformation, Modernization, Mobile and Cloud.
        • Work on a wide range of projects, languages and platforms
        • Build software and products that matter and make a difference

        Your Contribution:

        • Collaborate to translate client goals into technical requirements
        • Collaborate to design process and propose multiple solutions to the client’s business goals
        • Plan, pair and produce high quality source code and related assets with a razor sharp focus on delivering concise solutions to the client’s goals
        • Co-develop robust, automated test-suites throughout the project’s development
        • Leverage your tenacity, creativity, and the diverse expertise of your team to efficiently solve the never-ending stream of technical challenges that are the hallmark of software development
        • Prepare technical documents and handbooks to accurately represent application design and code
        • Communicate complex engineering concepts, challenges and tradeoffs effectively to both technical and non-technical clients
        • Initialize a Back End project with CI/CD, Automated Testing and a standard suite of developer tools (e.g. VSCode plugins for consistent code formatting)
        • Configure basic Cloud Services and DevOps (e.g. continuous deployment, common cloud services, databases and secrets management)
        • Effectively translate schema and architecture specs into API code
        • Collaborate with architect and lead engineers to maximize the team’s ability to quickly build a minimal, high quality back-end solution
        • Organize and build reusable UI components based on UX designs
        • Contribute, collaborate and co-develop front-end solutions (typically ReactJS)

        Your Experience:

        • 5+ years as a full stack Application Developer is required
        • Language fluency with at least two of: React, React Native, C#, Python, Elixir, and JavaScript is required
        • Platform expertise with at least one of: Flask, Phoenix, ExpressJS or NextJS is required
        • 5+ years as a full stack Application Developer is required
        • Language fluency with at least two of: React, React Native, C#, Python, Elixir, and JavaScript is required
        • Platform expertise with at least one of: Flask, Phoenix, ExpressJS or NextJS is required

        Preferred Experience:

        • Previous consulting experience is highly desired
        • Technical leadership in database schema planning and design
        • Experience with one or more relational database technologies: e.g. Postgres, MySql, SqlServer, etc...
        • Experience with one or more non-relational database technologies: e.g. MongoDb, CouchDb, DynamoDb, CosmosDb, etc...
        • Active technology consulting to discover effective client solutions
        • Prioritizing, tracking, and managing tasks with issue trackers (e.g. PivotalTracker, JIRA, or Azure DevOps)
        • Understanding and making complex CS and Software Engineering tradeoffs taught in a computer science degree or equivalent (e.g. modular design, algorithms, data structures and Big-O)

        Bonus Experience:

        • Development in diverse programming languages (e.g. Ruby, PHP, Go, Rust, CPP, C#, Java or Swift)
        • Development in diverse software platforms (e.g. RoR, Django, Laravel, Spring Boot or Asp.Net)
        • Development with a diverse range of databases (e.g. Postgres, MySql, SqlServer, DynamoDB, Mongo, Redis or Cosmos)
        • Collaborating or actively participating in product or UX design to achieve the best outcome

        Your Skills:

        • Great written and verbal communication skills
        • A positive, constructive, can-do attitude in tackling any problem in software development
        • A critical eye for quality, detail, and aesthetic in software development
        • Passion for technology and a high awareness of industry context and ongoing evolution of relevant technology
        • Enthusiasm for learning, collaboration and mentorship
        • Active relationship building to contribute to a flourishing, positive teamwork environment
        • Ego-free collaboration fluidly balancing responsibility for your personal contribution, asking for help and actively collaborating on solutions

        GenUI is an equal opportunity employer and all qualified applicants will receive consideration for employment without regard to race, color, religion, sex, national origin, disability status, protected veteran status, or any other characteristic protected by law.

        See more jobs at GenUI

        Apply for this job

        29d

        Senior Full Stack Software Engineer

        Prompt Therapy SolutionsParamus, NJ Remote
        postgreslaravelDesignrubymysqlangularNode.jsPHP

        Prompt Therapy Solutions is hiring a Remote Senior Full Stack Software Engineer

        Engineering at Prompt

        Prompt continues to disrupt the healthcare and medical billing industry by delivering innovative, technology-driven solutions. Our talented engineering team is dogma free and results driven. We are relentless in our drive to reliably deliver outstanding products at scale. We are growing fast, but we can go further, faster with experienced, collaborative, challenge-seeking engineers like yourself.

        As a Senior Software Engineer you will be a foundational piece to the growth of the product, team, and strategy at Prompt Therapy Solutions Inc. You will be one of the leaders in our development process driving concepts from ideation all the way to creation. Encourage the growth of our engineering team's strategy with your wisdom and experience in the industry. Help shape the engineering team by establishing best practices and hand picking the best talents on the market.

        At Prompt, Software Engineers are the keystones of our industry leading product and are the main reason we can deliver a high quality software that improves the lives of our customers each and every day.

        Responsibilities

        • Influence Engineering team strategy and product architecture
        • Create technical specifications for up and coming features
        • Oversee engineering grooming sessions and delegate feature development estimations
        • Mentor up and coming engineers
        • Develop new features for the Product
        • Participate and contribute to the Code Review process
        • Engage in Design Reviews, Product Retrospectives, and other team based ceremonies
        • Conduct technical interviews with candidates to help build the Prompt Team

        Qualifications

        • 5+ years of experience of software development experience with a focus on Full Stack web development
        • Strong communication skills and the ability to comfortably articulate you thoughts and decisions
        • Desire to contribute to the growth of the product, team, and direction of Prompt Therapy Solutions Inc.
        • A working knowledge of the technologies listed below
        • Enterprise engineering experience preferred
        • MVC architecture experience preferred

        Technology

        The ecosystem you will be working in.

        • Please have a working knowledge of PHP, Laravel, Vue.JS, and MySQL or any equivalent (Ruby, Node.JS, React, Angular, Ember, Postgres, MSSQL, etc.)

        • Please only apply if you are interested in a heavy code contribution role as we are not looking for engineering managers

        Perks

        What you can expect.

        • Competitive salaries
        • Equity compensation in the form of stock options.
        • 401k
        • Health Insurance Benefits
        • Generous PTO
        • Bi-Weekly company wide sponsored lunches'

        Culture

        Why work for Prompt?

        • BIG Challenges:
          Here at Prompt, we are solving complex and unique problems that have plagued the healthcare industry since the dawn of time.
        • Talented People:
          Prompt didn't happen by chance, it's a team of incredibly talented and proven individuals who all made their mark before joining forces to build the greatest software on the planet for physical, occupational, and speech therapists.
        • Healthy Approach:
          This isn't an investment bank, we work long hours when it's needed, but at Prompt you own your workload and the entire organization takes a liking to smart work (over hard work).
        • Environmentally Friendly:
          We are converting medical practices around the country into paperless operations. We aren't enthralled with patting ourselves on the back everyday, but it does feel good :)

        FAQ’s

        You might want to know…

        • Do I have to come to an office to do a job that is accomplished on a computer?
          No. This is a 100% remote position. Wear sweatpants, put your feet up, listen to Kanye, whatever you fancy is what you can enjoy in the comfort of your own home. If we have an office close by, we do love to get the team together when it makes sense.
        • Will I be working under a non-technical, slightly irritating "product manager"?
          No. Prompt has a flat management style and the only people you are working with are highly skilled and proven engineers.
        • Do I have to install a time tracker on my computer because you do not trust my work ethic?
          No. Prompt employees work around U.S. business hours in order to promote clear communication. You’d be expected to do the same within reason (and without time trackers). We are flexible and prioritize actual output over how long something took.
        • Will I be working on tedious projects that never make it to production?
          No. We don't have time to waste, your work in the first month here will be in the product, we 100% guarantee it.
        • Will the hiring process be dragged out?
          No. You will hear back quickly and we have a two day interviewing process, with both days being within a week of each other (or at your convenience). We know you are busy.
        • Is Prompt growing quickly?
          YES! Prompt grew 1600% in 2020 and we are on track to grow exponentially again this year.

        See more jobs at Prompt Therapy Solutions

        Apply for this job

        30d

        FULL Stack Laravel Developer (Full Time Remote)

        SOFTABMiami, FL Remote
        jiralaravelAWSjavascriptPHP

        SOFTAB is hiring a Remote FULL Stack Laravel Developer (Full Time Remote)

        Job brief

        We are looking for a Full-stack PHP Developer that is dedicated to the craft, writes code that they are proud of, and can hit the ground running. You will work as a part of a team responsible for all aspects of the ongoing software and web development from the initial specification to developing, testing, and launching.

        Responsibilities

        • Write “clean,” well-designed code
        • Document requirements with detailed specifications
        • Troubleshoot, test, and maintain software and databases to ensure robust optimization and functionality
        • Contribute in all phases of the development lifecycle, and be able to switch between projects as needed
        • Follow industry best practices
        • Develop and deploy new features to facilitate related procedures and tools if necessary

        Requirements

        • Proficiency in PHP, Laravel, Javascript, and Vue.js.
        • Knowledgeable about Composer, npm, and package management procedures
        • Experience integrating external APIs with the application.
        • Knowledge of DB transactions/schema etc.
        • Basic DevOps skills,
        • Experience building and interacting with RESTful APIs
        • As a bonus: Knowledge of AWS (S3, Lambda) and Laravel Nova.
        • As a bonus: Experience with Laravel
        • As a bonus: Experience using Jira and Bitbucket

        Who we are

        We are Softab. We build progressive websites and apps for multi-diversified brands. We excel in top of the notch websites & applications that are highly functional, unique, and impeccably designed. We strive to create digital experiences that merge creativity with advanced technology that drives results.

        Benefits

        • Paid Time Off (PTO)
        • Flexible schedule

        See more jobs at SOFTAB

        Apply for this job

        30d

        PHP/Laravel Developer (Remote Through COVID)

        sqllaravelDesignmysqlAWSPHP

        Latitude, Inc. is hiring a Remote PHP/Laravel Developer (Remote Through COVID)

        PHP/Laravel Developer (Remote Through COVID) - Latitude, Inc. - Career Page

        See more jobs at Latitude, Inc.

        Apply for this job

        30d

        PHP JAvaScript Full Stack Developer (Remote Online Education group)

        agilejirawordpressdrupallaravelDesigngraphqlsasshtml5symfonygitcssjavascriptNode.jsPHP

        Latitude, Inc. is hiring a Remote PHP JAvaScript Full Stack Developer (Remote Online Education group)

        PHP JAvaScript Full Stack Developer (Remote Online Education group) - Latitude, Inc. - Career Page

        See more jobs at Latitude, Inc.

        Apply for this job

        30d

        PHP Laravel Web Developer

        airflowlaravelDesignmysqlcssbackendPHP

        Latitude, Inc. is hiring a Remote PHP Laravel Web Developer

        PHP Laravel Web Developer - Latitude, Inc. - Career Page

        See more jobs at Latitude, Inc.

        Apply for this job

        +30d

        Senior WordPress Developer

        iGamingRemote
        nosqlwordpresslaravelmongodbapisymfonygitpostgresqlPHP

        iGaming is hiring a Remote Senior WordPress Developer

        Intro
        iGaming.com is an international Media Group with 11 years of consecutive outstanding performance offering business growth through affiliate marketing.  

        Our team of over ​300 talented and dedicated professionals develop, maintain and optimize websites ensuring they are well-designed and can be navigated intuitively. All content is tailored to experienced or interested players – we provide accurate, transparent, informative and up-to-date content around all aspects of igaming.  

        Why work with us at iGaming.com?  
        Because we are working to make a difference!

        Not only are we driven to provide the best experience for our users and exceed our partners’ expectations, we know that our team is our most important asset. Therefore, we focus on creating a work environment where everyone can learn new skills and further develop their career – be it inhouse workshops, training plans, online courses or external trainings. And we excel by providing a good work/life balance – giving you the flexibility to work where and when you want and much more. In fact, you can decide if you want to work remotely or from one of our offices, for example our Varna office.  

        We are continuing to grow and are hiring on all levels – Juniors, Experts and Managers.  
         
        We want to expand our team! We are currently looking for a Senior WordPress Developer
        These Tasks Await
        • Write server-side web application logic
        • Extend WordPress with custom modules/plugins/functionalities
        • Build new web applications
        • Help organize processes for most effective results
        • Handle security and performance issues related to scalable web application development
        • Be a member of a team of programmers working on iGaming solutions
        This Profile Is Matching With Us
        • 5+ years of experience in Web Development using PHP
        • Developing WordPress sites to requirements
        • Experience debugging themes and plugins
        • Excellent understanding of the WordPress database structure
        • Solid background in building scalable distributed products and practical experience with caching
        • Experience with relational databases (e.g. MySQL/MariaDB or PostgreSQL)
        • Good knowledge of the English language – spoken and written

        The chance to work with us is even bigger if you possess:
        • Experience with PHP frameworks (Symfony, Laravel, etc.)
        • NoSQL experience - MongoDB, Elastic, Redis
        • Experience with Git
        • Knowledge of RESTful patterns and API implementation

        We Offer You
        • Health Management: sports cards, additional medical coverage
        • Flexibility: flexible working hours. Remote work
        • Location of the main office: in the centre of Varna, 5 minutes away from the beach, a lot of possibilities: restaurants, cafés and shops, free parking
        • Environment: open-door policy, relaxed atmosphere, no dress code
        • Entertainment: regular company events and team buildings, PlayStation, board games
        • Support: language classes, regular feedback, internal development will be promoted
        • Safety: permanent employment contract, fair vacation days, attractive salary package
        • Internationality: an international team consisting of various professionals and highly motivated personalities
        If you feel like working with us, do not hesitate and apply today! Send us your CV and Cover Letter in English, plus References (if available). Or send this offer to a suitable friend!

        Only short-listed candidates will be contacted.

        All applications will be treated in strict confidentiality

        +30d

        (Senior) Backend Engineer

        InterNationsRemote or in Munich
        agileremote-firstkotlinscalamariadbRabbitMQlaravelDesignsymfonyrubyjavapythonbackendPHP

        InterNations is hiring a Remote (Senior) Backend Engineer

        About the Role

        Our engineering teams architect, develop, and test our products. As a Backend Developer, your mission is to build scalable and fast backend software for our platform which serves millions of views monthly. At InterNations you will contribute to connecting global minds and making expat life a great experience.


        As a member of an international, cross-functional Product Experience Team (PXT), you will architect, implement, and test new functionality and maintain existing functionality using web technologies.


        Our PXTs organize themselves using Agile methodologies and you will work closely with your Product Manager and your team on the feasibility of concepts and upcoming changes. You will write automated tests at the unit, integration, and acceptance levels to assure quality and longevity of our products and a sustainable pace for future changes.


        As part of the greater engineering organization, you will lead and take part in cross-team initiatives: architectural changes, refactoring, and establishment of best practices.


        What we are looking for:

        • We are working with PHP, so a relevant experience in a language like PHP, Java, Scala, Kotlin, Python, or Ruby is needed
        • Experience with a modern web framework like Symfony, Zend Framework, Laravel, Rails, Spring, or Django
        • Experience with automated testing, whether it’s unit, functional and/or acceptance testing
        • A strong interest for working with big datasets in relational databases, search indexes, or key-value stores
        • Relevant interest or experience with distributed systems and scalability

        What we value:

        • Bettering our skills, teaching each other and learning ways to build better software
        • User testing, experimentation, automated testing and continuous integration to gain meaningful feedback for what we do
        • Fostering collaboration and cooperativeness

        Technologies we use: PHP, Symfony, MariaDB, Solr, RabbitMQ, Redis, Memcached, Composer, Behat, PHPUnit

        What we’re working on right now: Get in on the ground floor of our brand-new SPA and design system that is transforming our entire product and development experience!

        Where we work: Although we’re based in Munich, Germany, our entire staff works across Europe. We are remote-first: all of our colleagues are free to work from home, the office, or elsewhere—or even a combination of those. We only ask that you join us from Europe.

        Sound interesting? Then send us your CV today!

        Want to get to know your future colleagues a bit better? In this interview on our corporate blog, one of our Team Lead Software Engineering talks about his experience as a backend engineer at InterNations and what our company culture is like.

        About us
        With over 4 million members in 420 cities worldwide, InterNations is the largest global community for people who live and work abroad. InterNations offers global and local networking and socializing, both online and face-to-face. At around 6,000 events and activities per month, expatriates can meet other global minds and pursue their interests. Members can also find and exchange tips and information on life abroad through discussion forums and helpful articles based on personal expat experiences. Membership is by approval only to ensure quality and trust in our community. InterNations is part of New Work SE, a group of brands that offer products and services for a better working life.

        Although we have offices in Munich, Germany, we're a remote-first company. All team members are free to work anywhere in Europe — from home, the office, or a combination of both. You can read more about InterNations becoming a remote-first company in our company blog.

        You can find more information about InterNations on our press page, on our about pages, or in our company blog.

        Benefits of working at InterNations:
        • a growing, dynamic company with an international team
        • a centrally located HQ office in Munich
        • the possibility to work fully remote anywhere in Europe
        • support with your visa application
        • an ongoing sustainability initiative — we’re a climate-neutral company
        • a friendly atmosphere and the space to pursue your ideas
        • 28 paid vacation days and special paid leave
        • the option to take a sabbatical after 3 years with InterNations
        • part-time work contracts possible
        • Albatross Membership for team members and their partners
        • XING Premium membership
        • regular team bonding events to connect our team members wherever they are
        • regular workshops, training sessions, cross-departmental projects & exchanges

        At InterNations, you’ll be working in a friendly atmosphere geared toward bringing out your creativity and independence. With our flat organizational structure, you’ll have lots of room to pursue your own ideas. If you’re a working parent, you’ll find the flexibility you need to support your work-life balance. All team members can work remotely anywhere in Europe, or from our Munich office. And as we value building strong connections between our team members, especially in a remote setting, you can look forward to coffee lotteries, language tandems, department exchanges, and regular team-bonding activities.

        See more jobs at InterNations

        Apply for this job

        +30d

        Senior PHP developer (Sendios)

        GenesisKyiv, UA
        RabbitMQlaravelsymfonyelasticsearchmysqlPHP

        Genesis is hiring a Remote Senior PHP developer (Sendios)

        See more jobs at Genesis

        Apply for this job

        +30d

        Senior Laravel Developer

        IntiveoVancouver, BC Remote
        3 years of experienceremote-firstlaravelslackscrumqaAWSjavascriptbackendPHP

        Intiveo is hiring a Remote Senior Laravel Developer

        Senior Laravel Developer

        Hello! ????
        We need a Senior Laravel Developer to guide our technology to the next level. This position reports to our Lead Laravel Developer and they will work closely with the product development team to ensure our SaaS product continues to grow and scale efficiently.

        Who We Are
        Intiveo is a popular patient communication SaaS product used by 14,000 medical practitioners to communicate with over 18 million patients.
        We are a remote-first company and we do it well!
        Our goal is to continuously improve patient care by understanding communication needs, behaviours, and preferences

        ✨What You’ll Do

        • Contribute in and coach the product development scrum team to groom, plan, and deliver high-quality product to our customers
        • Code in our Laravel codebases and communicate with your teammates to find efficient solutions
        • Collaboratively brainstorm improvement of our existing product and creation of new product modules
        • Architect backend processes to solve complex workflows, including collaboration with your DevOps and QA teammates
        • Structure front-end JavaScript (including React.js) and Blade template code keeping an eye on simplicity
        • Learn and acquire new skills, broaden your existing skills, and contribute to others through knowledge sharing
        • Participate in code reviews and deployments as part of the regular sprint cadence
        • Identify and assist removing obstacles that would prevent engineers from consistently delivering high-quality results
        • Stay up-to-date with tools and techniques that will improve the engineering team's productivity

            ✨Who You Are

            • Minimum 3 years of experience with PHP
            • Minimum 2 year of experience with Laravel and modern JavaScript frameworks like React.js, Vue.js, etc.
            • Excellent communication skills, both verbal and written
            • Great organizational and time management skills
            • Team player with emphasis on coaching and teaching
            • Analytical thinker with problem-solving capabilities while being able to put on the hat of the end uses
            • You stay up-to-date on the latest trends and best practices in Laravel development
            • You are passionate about solving problems with the ability to see from the user’s experience
            • You live in Canada ????

            ✨Bonus

            • Exposure with common AWS services
            • Skilled with Slack emojis

              More About Intiveo

              At Intiveo, we are committed to creating a culture that is inclusive and welcoming of different perspectives, life experiences, cultures and identities. We believe that our differences make us stronger and that many unique perspectives, experiences and backgrounds make for better ideas and more well rounded decisions. Simply put, we love our diversity!

              Want to see more? Check out our Culture Book here!


                See more jobs at Intiveo

                Apply for this job

                +30d

                Full Stack Engineer (m/f/d) - 100% remote possible

                PlaytestCloudGermany Remote
                3 years of experiencelaravelDesignswiftmobileiosflutterrubyjavac++androidangularbackendfrontend

                PlaytestCloud is hiring a Remote Full Stack Engineer (m/f/d) - 100% remote possible

                ABOUT PLAYTESTCLOUD

                PlaytestCloud is a platform that lets gamers worldwide try out games and help game studios improve them by providing feedback. Over 60% of the studios listed in the App Store Top 100 grossing games charts have tested their games with PlaytestCloud.

                • We’re the premier user testing provider for mobile games - we help game studios worldwide make the best games they possibly can
                • We build our own technology that adds screencast recording, security features, and player instructions to games
                • We’re bootstrapped and profitable, with 300+ paying game studios and 1,000,000+ playtesters

                THE ROLE

                We’re looking for a Full Stack Engineer (f/m/d) to help bring exciting new features to market. Tasks that you might work on include, but are not limited to:

                • Develop new functionality for the PlaytestCloud platform web application backend and frontend (Ruby on Rails and Angular)
                • Implement user interfaces based on mock-ups from our UI/UX designer
                • Make your own architecture and design choices
                • Dip your toes into mobile development with Flutter

                Our code bases:

                • Web application: Ruby on Rails/TypeScript/Angular
                • PlaytestCloud App (iOS/Android): Flutter
                • PlaytestCloud iOS SDK: Swift, Objective-C
                • Recording Library (Android): Java

                YOUR PROFILE

                Mandatory:

                • You enjoy working in multiple programming languages and frameworks
                • You have a customer-focussed mindset and like to bring valuable features to market
                • You have at least 3 years of experience working as a full stack engineer.
                • You have experience with backend web development (any MVC framework such as Django, Laravel or ideally Ruby on Rails)
                • You have experience working with front-end frameworks (for example React, Vue.js or ideally Angular)
                • You are interested in learning about mobile development (Flutter, iOS, Android). Prior experience is not required though
                • You are located within ±2 hours of the Europe/Berlin time zone

                Optional:

                • You like video games and would enjoy working in the gaming industry

                YOUR BENEFITS

                Here comes the fun part! If you love a less-formal work environment, flexible work hours and location, a competitive compensation package and benefits - and most of all, being the authentic you - we want to meet you. Here are some of our perks & benefits:

                • Hybrid work model: We offer the option to work up to 100% remotely. Nevertheless, you're also welcome to work from our office in beautiful Berlin-Charlottenburg
                • You get a budget for professional growth opportunities, conferences, team building, and, if you wish, German language lessons
                • 27 vacation days + additional time off on December 24th and 31st
                • You get a MacBook Pro, two screens, and all equipment you need to do a great job
                • You get a budget to set up your home office environment
                • Strong culture: We have a feedback-driven company culture that is open to trying new paths, where the best idea wins
                • Team events, (board) game sessions and other fun activities for everyone who wants to attend
                • Pet-friendly office
                • Birthday Presents
                • Anniversary Charity Donations
                • Summer & Winter parties
                • Liberal policy around working from countries that are not your primary residence (workations)
                • Our company language is English

                DO YOU NEED TO MEET ALL HIRING CRITERIA?

                ​​A common question you might be asking is: “Do I need to meet all the requirements to apply?”

                Our answer is, studies by several different sources have shown that, on average, men will apply for a job if they meet 60% of the application requirements. By contrast, women/non-binary people will seek to match a much higher percentage of the requirements before applying. We encourage everyone to apply and give us a chance to evaluate your skills and experience. We are all learning on the job, and although the listing above has been carefully compiled, we are also open-minded and interested to hear about the value you can bring to the role, and to PlaytestCloud.

                EQUAL OPPORTUNITY EMPLOYER

                At PlaytestCloud, we welcome diversity, and believe everyone should have a fair chance at setting a high score. We are committed to providing an inclusive environment for everybody who works here or with us, regardless of race, national origin, age, gender, gender identity or expression, sexual orientation, religion (or lack thereof), political affiliation, disability, medical condition, pregnancy, marital status, or any other protected characteristics. Join us and make the future of mobile gaming diverse, inclusive, and exciting.

                See more jobs at PlaytestCloud

                Apply for this job

                +30d

                Senior PHP Developer

                MessageMediaPhilippines Remote
                agilejiralaravelDesignapigitPHP

                MessageMedia is hiring a Remote Senior PHP Developer

                Headquartered in Australia, ClickSend is business communications software providing companies of all shapes and sizes the ability to easily send and receive SMS, MMS, Rich Media, Email, Voice and even Post worldwide via web app or API. ClickSend has SMS at its core and powers billions of messages worldwide but has expanded to offer a full suite of products providing choice and context to business communications. ClickSend forms part of the MessageMedia Group and have all the benefits of being part of a larger group but still retain their ‘start-up’ mentality.

                ClickSend is looking to recruit a PHP Developer to work remotely from the Philippines.

                Reporting to the Software Development Manager, located in Western Australia, key responsibilities of the PHP Developer is to work alongside the customer support and emergency response team.

                Key responsibilities will include the following:

                • Write PHP code to extend, enhance, and occasionally repair, our existing V3 platform.
                • Write tests to automatically test the same code.
                • Participate in an agile software development team alongside testers, developers, and product owners to deliver quality software in a timely manner.
                • Report on status during standup meetings.
                • Participate in design meetings as required.
                • Propose innovative solutions to increase performance and quality while lowering total costs.


                The ideal candidate will possess the following attributes:

                • Proven experience in PHP programming with Laravel
                • Agile software development exposure.
                • Working knowledge in REST API development.
                • Experience with Jira, Git, GitHub highly desirable


                If interested in this opportunity, please attach your resume/CV to your application.

                Salary will be dependent on experience.

                See more jobs at MessageMedia

                Apply for this job

                +30d

                Drupal Developer(Remote)

                drupallaravelDesignPHP

                Latitude, Inc. is hiring a Remote Drupal Developer(Remote)

                Drupal Developer(Remote) - Latitude, Inc. - Career Page

                See more jobs at Latitude, Inc.

                Apply for this job

                +30d

                PHP Fullstack Developer (Mid/Senior)

                DropticaRemote job, Remote
                sqlB2BdrupallaravelvueansiblesymfonygitlinuxangularjenkinsPHP

                Droptica is hiring a Remote PHP Fullstack Developer (Mid/Senior)

                Dołączenie do Droptica to:

                • Praca z technologiami jak Drupal (większość projektów w firmie), Mautic, Sylius, Pimcore, Symfony, Laravel.
                • Współpraca z klientami z całego ???? w jednej z najlepszych firm w skali światowej wdrażających serwisy oparte o Drupala,
                • Regularna nauka - firma rośnie i rozwija się bardzo szybko, a z nią pracownicy,
                • Dostęp do licznych materiałów szkoleniowych, treningów, specjalistycznych książek, konferencji i warsztatów,
                • Wpływ na rozwój firmy i możliwość aktywnego rozwijania i popularyzacji oprogramowania OpenSource ????
                • Elastyczne godziny pracy, możliwość pogodzenia pracy i nauki, hobby i życia osobistego,
                • Komfortowe miejsce pracy i wysokiej jakości sprzęt,
                • Wsparcie kolegów i koleżanek z zespołu, miła atmosfera i częste spotkania integracyjne,
                • Poczucie bezpieczeństwa i stabilności, jasne zasady,
                • Karta Multisport i możliwość skorzystania z opieki medycznej (PZU),
                • Czwartkowe obiady w biurach ????
                • Tydzień w Innym Biurze - to nasza autorska inicjatywa integracyjna
                • Udział w spotkaniach i konferencjach, które sponsorujemy i organizujemy,
                • Możesz zostać prelegentem lub autorem tekstów na naszym blogu ????
                • Dowiedz się więcej o Droptica na stronie https://kariera.droptica.pl ????????

                Wynagrodzenie:

                  • B2B: 8 000 - 16 000 zł netto. Możliwe również UOP i UZ w PL. 

                Miejsce:

                Wrocław, Gdańsk, Toruń, Rzeszów lub 100% zdalnie z Polski

                Wymagania: 

                • Minimum 2 lata komercyjnego doświadczenia w tworzeniu aplikacji webowych lub serwisów internetowych z wykorzystaniem PHP 
                • Znasz minimum jedną z technologii: Drupal, Symfony, Laravel.
                • Dobrze znasz HTML/CSS/jQuery i SQL
                • Bez przeszkód porozumiewasz się po polsku i po angielsku (poziom B2).

                Jeśli nie znasz, nauczymy Cię:

                • Drupal, Symfony i Laravel.
                • Git, Docker.
                • Jenkins, Ansible, SASS.
                • System linux (Podstawy LAMP).
                • Command line, bash.
                • Frameworki JS (Angular, React, Vue).

                Nad czym będziesz pracować:

                • Tworzenie nowych aplikacji internetowych opartych o PHP (Drupal, Symfony, Laravel) - fullstack.
                • Praca z technologiami jak Mautic, Sylius, Pimcore.
                • Rozwój istniejących aplikacji webowych i dużych serwisów internetowych.
                • Rozwój aplikacji dla dużych międzynarodowych korporacji jak również małych i średnich firm, duży przekrój klientów.
                • Planowanie architektury nowych aplikacji i serwisów internetowych.

                See more jobs at Droptica

                Apply for this job

                +30d

                Fullstack Software Engineer

                Blue Orange DigitalRio de Janeiro, BR Remote
                5 years of experiencelaravelDesignazurescrumdockertypescriptlinuxAWSjavascriptbackendfrontendNode.js

                Blue Orange Digital is hiring a Remote Fullstack Software Engineer

                Blue Orange is seeking a Fullstack Engineer to join our team to help our clients build robust data-driven web applications. Blue Orange builds enterprise data platforms and systems for a variety of clients, this team member will be working with our data and application teams to build applications that make the output of our data systems connect with end-users and become interactive. The candidate will work closely with and collaborate with our Blue Orange team members as well as with our clients, who will drive the requirements.

                This is a full-time, fully remote role for Latin American candidates. Applicants must have strong written and oral communication in English. Must be within +/- 3 hours of Eastern Standard Timezone (NYC).

                You must have:

                • Frontend experience:
                  • React (preferred) or another similar front-end framework
                  • Javascript is a must
                  • Typescript experience is a plus
                  • HTML/CSS
                • Backend experience:
                  • Node.js preferred
                  • Backend framework(s) experience
                  • Nest.js is a plus
                • Other Examples:
                  • Express.js, Spring Boot, Django Laravel, ASP.NET, Fiber, etc
                  • General Software Engineering Experience (docker, Linux, etc)

                Core Responsibilities & Skills:

                • Work with clients and data teams to help design, build and deploy web applications written in React, Next.js, and Nest.js in AWS.
                • Use sound engineering practices to test your applications (Unit tests, integration tests, etc)
                • Implement and maintain best practices for application development within the team. Constantly be vigilant for ways to improve the systems you are building.
                • Own the deployment processes for the software you build
                • Engage in Code Reviews, and Scrum meetings and follow SDLC best practices.
                • Develop reusable, automated processes, and tooling surrounding the applications you are building.
                • Knowledge of best practices related to security, performance, and disaster recovery.
                • Experience working in cloud environments, AWS is preferred
                • Enjoys collaborating with other engineers on architecture and sharing designs with the team.
                • Excellent verbal and written English communication.
                • Interacts with others using sound judgment, good humor, and consistent fairness in a fast-paced environment.

                Required Previous Experience:

                • At least 5 years of experience building and supporting enterprise full-stack applications.

                  Required Education:

                  • BA/BS degree in Computer Science or a related technical field, or equivalent practical experience.

                  Bonus Points:

                  • Hold certifications for Azure Developer, Azure DevOps, or Azure Data Fundamentals

                  Salary: $50,000 - $75,000 USD per year

                  See more jobs at Blue Orange Digital

                  Apply for this job