tailwind Remote Jobs

24 Results

2d

Front End Developer

agiletailwindDesignPhotoshopvuejquerymobilesassuihtml5UXgitc++cssangularjavascriptNode.js

Veracity Consulting Group is hiring a Remote Front End Developer

Front End Developer - Veracity Consulting Group - Career Page
2d

Sr. Front End Developer

agiletailwindDesignPhotoshopvuejquerymobilesassuihtml5UXgitc++cssangularjavascriptNode.js

Veracity Consulting Group is hiring a Remote Sr. Front End Developer

Sr. Front End Developer - Veracity Consulting Group - Career Page

See more jobs at Veracity Consulting Group

Apply for this job

3d

Senior Front End Engineer

RiderfleRemote
agiletailwindDesignmobileazureuihtml5scrumUXgitjavac++c#.netangularjavascript

Riderfle is hiring a Remote Senior Front End Engineer

Senior Front End Engineer - Riderflex - Career PageSenior Front E

See more jobs at Riderfle

Apply for this job

14d

WordPress Developer

AprioritUkraine Remote
jirawordpresstailwindDesignjqueryhtml5scrumapigitdockermysqllinuxjavascriptPHP

Apriorit is hiring a Remote WordPress Developer

Apriorit is a software engineering company, which was established in 2002, and has extensive experience in system programming, cybersecurity, reverse engineering, SaaS/web, blockchain-based solutions, and artificial intelligence.

Working with high-profile clients (including Fortune 500 companies) for 20+ years, we have established high standards in software development, communication, and effective teamwork.

Our headquarters are in the US, with EU offices in Budapest and Poland, and three R&D offices in Ukraine. Our team consists of over 350 specialists, and we assist tech companies worldwide to turn their challenging ideas into secure and viable products.

Job description

We are currently looking for an experiencedWordPress Developerto join our team andwork on an internal corporate website using best practices in WordPress development.

Key responsibilities:

  • Implementation of new features
  • Fixing issues and improvement of existing features

Skills and experience:

  • 2+ years experience in WordPress development
  • Significant knowledge of PHP, and MySQL
  • Knowledge of front-end technologies: CSS3, JavaScript, HTML5, and jQuery
  • Experience working with debugging tools (Chrome Inspector and Firebug)
  • Good understanding of website architecture and aesthetics (UI/UX)
  • Experience with version control systems (Git, SVN)
  • English language level: Pre-Intermediate or higher
  • Excellent communication skills

Nice to have –experience with:

  • Scrum
  • Atlassian stack (Bitbucket, Confluence, Jira)
  • Bootstrap, Tailwind, Foundation by Zurb, etc.
  • Docker
  • Xdebug
  • Rest API
  • Linux

Perks & benefits:

  • Online interview process
  • Dynamic project with modern design
  • Career development and professional growth
  • Personalized learning approach (mentoring, training courses, sharing knowledge, etc.)
  • Free corporate English lessons with a native speaker
  • Experienced team and friendly working atmosphere
  • Flexible hours and remote work
  • Attractive salary reflecting your experience
  • Paid vacation and sick leave
  • Medical insurance and compensation for sports
  • Equipment provided (laptop, monitor, accessories)

If you are interested in this position, please send us your detailed CV.

Apriorit – A Priority Choice!

See more jobs at Apriorit

Apply for this job

17d

Senior Full stack Ruby on Rails Developer

DevelopexKyiv, UA Remote
postgrestailwindrubycss

Developex is hiring a Remote Senior Full stack Ruby on Rails Developer

We're looking for an experienced Full Stack Engineer to drive progress on our customer-facing web application.

About the project - is a smart irrigation system that helps growers save water, improve crop quality and reduce costs.

A strong candidate would have:

  • 2+ years full-time Rails experience;
  • 5+ years Full Stack experience;
  • The initiative, result-driven and self-motivated;
  • Well-developed oral and written communication skills;
  • Upper-intermediate level of English.

And would have experience in the following stack:

  • Rails 7;
  • RSpec for tests;
  • Postgres for DB;
  • Tailwind for CSS;
  • Stimulus and Turbo.

We offer:

  • Flexible working schedule;
  • Working remotely;
  • English lessons & Yoga classes;
  • Paid seminars, online courses, professional literature;
  • Events: Developex travel club, movie nights, table games, etc.

See more jobs at Developex

Apply for this job

+30d

Web Application Developer ( REMOTE)

agilesqltailwindDesignjqueryazurehtml5apic++.nettypescriptcssangularAWSjavascript

Help At Home is hiring a Remote Web Application Developer ( REMOTE)

Web Application Developer ( REMOTE) - Help At Home - Career PageCollaborating with IT / Developers for other sy

See more jobs at Help At Home

Apply for this job

+30d

React Developer

FlureeWinston-Salem, NC Remote
tailwindFirebasemongodbgraphqlgittypescriptjavascriptbackend

Fluree is hiring a Remote React Developer

  • Summary
    • We are seeking a front-end developer with experience with React and NextJS. You'll work as part of a team to deliver front-end components of our cloud database platform.
    • As a Fluree front-end developer, you will implement new features and maintain existing code using React and NextJS. Your duties will include designing software solutions to meet project requirements, maintaining and refactoring existing code, writing tests, and fixing bugs.
  • React Developer Essential Duties and Responsibilities
    • Development of new user-facing features using React
    • Build reusable components and front-end libraries for future use
    • Translate designs and wireframes into high-quality code
    • Communicate with team members to coordinate development efforts
    • Ensure code quality and standards compliance
  • React Developer Required Skills and Abilities
    • Strong proficiency in JavaScript, including DOM manipulation and the JavaScript object model
    • Thorough understanding of React and its core principles
    • Experience with NextJS
    • Familiarity with backend APIs (i.e., GraphQL)
    • Proficient understanding of code versioning tools, such as Git
    • Excellent communication skills, both written and verbal
    • An understanding of common programming paradigms and fundamental React principles, such as React components, hooks, and the React lifecycle
    • Experience with Typescript
    • Experience with Tailwind
    • Experience with cloud databases like MongoDB, Firebase, DynamoDB, etc., is a plus
    • Familiarity with semantic and linked-data standards (e.g., RDF, JSON-LD) is a plus
  • React Developer Education and Experience
    • Bachelor’s degree in Computer Science or related field or equivalent work experience
    • Minimum of 3 years of professional work experience

See more jobs at Fluree

Apply for this job

+30d

Ruby on Rails backend developer (Remote, Work from Anywhere)

LifetimelyHelsinki, FI Remote
sqltailwindslackgitrubycssjavascriptbackend

Lifetimely is hiring a Remote Ruby on Rails backend developer (Remote, Work from Anywhere)

+30d

Backend Developer (PHP)

CoveSingapore, SG Remote
Bachelor's degree5 years of experiencewordpresstailwindlaravelDesignapigitmysqlcsslinuxbackendfrontendPHP

Cove is hiring a Remote Backend Developer (PHP)

About Cove: Cove is the new way to rent your home! We’re a co-living start-up making it easier and more affordable for young people to have a comfortable place they can call home with a seamless rental experience from end to end. We provide our tenants with stylishly furnished properties, in the most awesome locations in Singapore and Jakarta and make the whole rental process seamless from end to end. Our contract terms are flexible like our tenant’s lives and our rental prices include everything from utilities and wifi and weekly cleaning. What’s unique about Cove is that our tenants get matched with great flatmates and also have access to our community events around the city. Check us out for more exciting information at https://cove.sg.

At Cove we reward and praise strong performance and strive to produce zero-defect results. We always aim for excellence and to always have the mindset of continuous improvement. In achieving results, we still make work fun and we completely value our team as people, not just resources in which we display care as well as empathy. Celebrating success with our team is also our priority and we highly encourage integrity and transparency.

Job Title: Backend/Fullstack Developer (PHP)

Job Type: Permanent (Open to a remote position nearby GMT+8)

Start Date: ASAP

Reports To: Head of Engineering

Role Purpose:This role will support web development initiatives in the Company. We're open to having applications that can work equal to SGT (GMT+08).

Responsibilities:

  • Develop and maintain our Laravel backend and its integration with the Property Management System
  • Work with external APIs, build and maintain other integrations
    • Collaborate with other Tech team members to design and develop products and features
    • Produce clean and maintainable code

      Requirements:

      • Bachelor's Degree in Computer Science/math
      • 5 years of experience in PHP (PHP 7, Laravel/Symfony)
      • SOLID/KISS/DRY
      • MySQL, Redis
      • Experience in designing and building REST API
        • Unit testing
        • CI/CD, Linux, nginx, git
        • Have systemic thinking, proactivity, ability to work independently, following best practices, curiosity, and desire to constantly learn

        Nice to have:

        • Experience in Frontend (React.js, Next.js, Tailwind CSS)
        • WordPress

        What’s in it for You:

        Working for Cove gives you the opportunity to join an exciting young start-up incubated through Antler.co. In your role, you’ll have the opportunity to hit the ground running and take ownership from day one. We will always welcome your input and ideas and actively encourage your development. The team is fast-paced, hard-working, and expects results but we also highly value our employee engagement and are committed to a human and empathetic environment with plenty of fun thrown in.

        See more jobs at Cove

        Apply for this job

        +30d

        Frontend Engineer, Remote/Boston, MA

        tailwindDesignuicssfrontend

        Maania Consultancy Services is hiring a Remote Frontend Engineer, Remote/Boston, MA

        Frontend Engineer, Remote/Boston, MA - Maania Consultancy Services - Career Page

        See more jobs at Maania Consultancy Services

        Apply for this job

        +30d

        Backend Laravel PHP Web Engineer

        Blue Ocean IdeasTowson, MD Remote
        tailwindlaravelgitmysqltypescriptcsskubernetesbackendfrontendPHP

        Blue Ocean Ideas is hiring a Remote Backend Laravel PHP Web Engineer

        We're looking for someone with very strong back-end skills who is an expert in Laravel. You will be working on a recently launched large association management platform built from the ground up with modern techniques in Laravel.

        About You

        You're a strong problem solver who loves to learn — we're not experts in everything and we don't expect you to be either.

        You are passionate about building great software. Quality is very important to you. You understand the value of testing: unit tests, integration tests, performance tests, etc.

        We don't care if you went to school, we just care about what you can do and how you do it. We're all just makers and tinkerers, so as long as you love to build awesome stuff you'll fit right in.

        What you’ll need

        • Strong experience building complex applications with Laravel.
        • Experience writing tests and using PHPUnit.
        • Strong experience with Git and working with a team using code version control.
        • You've worked on large-scale web applications.
        • Knowledge of React is a plus.

        Our Technology Stack

        • Backend
          • PHP
          • Laravel
          • MySQL
          • Redis
          • Algolia
          • Pusher
        • Frontend
          • React / Intertia.js / TypeScript
          • Tailwind CSS
          • Blade
        • Devops:
          • Octane
          • Kubernetes
          • FluxCD

        About Us

        Blue Ocean Ideas solves problems with Truth, Goodness, and Beauty. We’re building the next generation of Association Management Software. We look for team members exhibiting our virtues, core competencies, and role competencies in their domain.

        Our Virtues

        • Wisdom – Knowing how to act in any situation
        • Fortitude – Showing strength and courage
        • Temperance – Exhibiting moderation
        • Justice – Treating everyone equitably
        • Faith – Believing in the best of people and situations
        • Hope – Seeing a bright future and moving toward that future
        • Love – Acting for the benefit of others

        Our Core Competencies

        • Simplify: Things should be made as simple as possible, but no simpler
        • Organize: Things are in order consistently
        • Anticipate: Sees the future and adjusts accordingly
        • Communicate: Clear, forthright, open, honest

        Benefits

        • 401k
        • Flexible time off policy
        • Health insurance (HSA with compatible plans)
        • Dental insurance
        • Vision insurance
        • Life insurance
        • Long-term disability insurance
        • Apple MacBook Pro + second screen

        See more jobs at Blue Ocean Ideas

        Apply for this job

        +30d

        Growth Marketing Lead

        PopSQLRemote
        terraformsqltailwindDesigngraphqlapipostgresqltypescriptcssAWSjavascriptbackendfrontend

        PopSQL is hiring a Remote Growth Marketing Lead

        Growth Marketing Lead at PopSQL (S19)
        SQL editor for teams
        Remote
        Full-time
        About PopSQL

        Every company wants to use data to make informed decisions, and SQL is the lingua franca for data. However, data collaboration is broken. People are rewriting each other's queries, switching apps to visualize their data, and copying/pasting SQL into Slack.

        PopSQL solves this by creating a beautiful, fun way to write SQL, visualize data, and share results. The product is loved by data teams from over 2000 companies including DoorDash, Shipt, Redfin, and Optimizely. What we've built so far is just the beginning. Join us and build a great product, a great culture, and a great company ????

        About the role

        About PopSQL

        Every company wants to use data to make informed decisions, and SQL is the lingua franca for data. However, data collaboration is broken. People are rewriting each other's queries, switching apps to visualize their data, and copying/pasting SQL into Slack.

        PopSQL solves this by creating a beautiful, fun way to write SQL, visualize data, and share results. The product is loved by data teams from over 2,000 companies including Target, Redfin, and Udacity. What we've built so far is just the beginning. Join us and build a great product, a great culture, and a great company ????

        About the role

        • Craft and execute PopSQL’s demand generation strategy across digital marketing campaigns and programs to generate leads and grow pipeline.

        • Embrace product-led growth (PLG) techniques to understand and improve our conversions across all customer touchpoints–from top to bottom of the marketing funnel to stages of the user journey (i.e. activation, adoption, retention and advocacy).

        • Partner with sales and product on metering and measuring success, improving lead scoring and enabling seamless handoffs between marketing, sales and customer success. 

        • Build a world-class marketing tech stack that supports our self-service and sales-assisted motions, while putting us on the map as experts on what modern, growth marketing looks like in the data science space.

        About you

        • 6+ years of experience running growth marketing, demand generation, digital and lifecycle marketing at SaaS/Dev Tool companies. Hypergrowth experience is a plus.

        • Battle-tested knowledge across a variety of growth channels: SEO, paid ads, content marketing, email, community building, social media, etc. Much of our growth has been organic to date, and we’re looking to identify the areas of investment that will help accelerate it. You can direct our team go deep on certain tactics, while leveraging and managing vendors to execute across others. 

        • Experience with PLG, freemium/free trial, and/or hybrid (top down + bottom up) models.

        • A knack for wrangling data and analytics to uncover insights, testing hypotheses, and reporting results.

        • Always be experimenting. You will encourage us to quickly test and iterate across tactics to pinpoint where we can maximize our efforts. 

        • A desire to join a team to build a company, do great work with great people and have fun while doing it.

        Benefits

        • Competitive salary and equity

        • 100% medical, dental, and vision insurance for you and your family

        • 401k

        • Life insurance

        • Flexible working schedule and unlimited vacation policy

        • MacBook Pro or equivalent 

        • Company retreats 2-3 times per year

        Location

        Our team is spread throughout the Americas. You're free to choose your own hours and schedule your day in such a way that creates work-life harmony.

        Technology

        Frontend

        • React application using hooks written in JavaScript and a bit of TypeScript
        • Apollo to fetch data from our GraphQL API
        • Storybook component library
        • Electron to power our cross platform desktop application
        • Next.js to build server side rendered static sites
        • Tailwind CSS

        Backend

        • Rails hosted on AWS ECS
        • GraphQL API
        • PostgreSQL for our primary data store, Redis and Memcached for caching
        • Terraform for infrastructure as code

        Practices

        • We love to weave testing, analytics, logging, monitoring, and alerting into our projects
        • Continuous integration/delivery
        • GitHub pull requests/code reviews
        • Quick daily synchronous product meetings to demo progress and get rapid feedback from your peers

        See more jobs at PopSQL

        Apply for this job

        +30d

        Customer Success Executive

        CosmicRemote
        remote-firsttailwindDesignmongodbapitypescriptAWSfrontendNode.js

        Cosmic is hiring a Remote Customer Success Executive

        Customer Success Executive at Cosmic (W19)
        Cosmic is a headless CMS and API toolkit
        Remote
        Contract
        Any (new grads ok)
        About Cosmic

        Cosmic is a headless CMS and API toolkit to help teams build modern apps faster, together. We provide a web dashboard to create content and API tools to deliver content into any website or app.

        About the role

        Cosmic is transforming the way content is created and delivered to the world. We provide a headless CMS to help teams build modern content-powered apps together.

        We are currently looking for an Customer Success Executive to help our customers get more value out of their use of Cosmic.

        If selected to join our team, you would be expected to be self-starting and provide quality, quantifiable results for our remote-first company.

        Contact [email protected] with the subject "Customer Success Executive" to apply.

        Technology

        AWS Serverless Node.js MongoDB

        See more jobs at Cosmic

        Apply for this job

        +30d

        Software Engineer

        CosmicRemote
        tailwindDesignvuemongodbapigittypescriptcssAWSjavascriptfrontendNode.js

        Cosmic is hiring a Remote Software Engineer

        Software Engineer at Cosmic (W19)
        Cosmic is a headless CMS and API toolkit
        Remote
        Contract
        Any (new grads ok)
        About Cosmic

        Cosmic is a headless CMS and API toolkit to help teams build modern apps faster, together. We provide a web dashboard to create content and API tools to deliver content into any website or app.

        About the role
        Skills: CSS, HTML, JavaScript, MongoDB

        We're looking for a talented software engineer with skills in Node.js, MongoDB and API development. You'll be tasked with developing and maintaining the core application components for Cosmic: The APIs, Web Dashboard, Database and general infrastructure.

        Skills required:

        JavaScript Node.js API development MongoDB Git version control

        Bonus points: AWS dev ops experience Frontend development experience (React / Vue)

        Contact [email protected] to apply.

        Technology

        AWS Serverless Node.js MongoDB

        See more jobs at Cosmic

        Apply for this job

        +30d

        UX Developer

        agiledrupaltailwindDesignmobilesassuiscrumUXtypescriptcssangularjavascriptPHP

        Portland Webworks is hiring a Remote UX Developer

        UX Developer - Portland Webworks - Career Page

        See more jobs at Portland Webworks

        Apply for this job

        +30d

        Full Stack Java/React Developer

        agilenosqltailwindDesignmobilegraphqlsassuiscrumapiUXjavatypescriptAWSjavascript

        Portland Webworks is hiring a Remote Full Stack Java/React Developer

        Full Stack Java/React Developer - Portland Webworks - Career Page

        See more jobs at Portland Webworks

        Apply for this job

        +30d

        Front-End Software Engineer

        Cape IncRemote, New York, United States
        tailwindDesignUXtypescriptjavascript

        Cape Inc is hiring a Remote Front-End Software Engineer

        Cape Privacy is looking for a front-end software engineer to help build and evolve our innovative encrypted predictions product. Ideal candidates will have meaningful experience building public customer-facing web applications. Cape is a fully-remote, growing startup, and we are looking for team members in the United States and Canada.


        Responsibilities:

        • Collaborate with Product and UX design team on user interface specifications.
        • Collaborate with software engineers on design and development of user interface APIs.
        • Implement functional, elegant, efficient, and delightful web-based user interfaces.
        • Conduct thorough testing and integration of your work.
        • Conduct thoughtful reviews of teammates' work.
        • Manage individual project priorities, deadlines, and deliverables.
        • Participate in stand-up meetings to review progress and perform planning.
        • Stay current with web interface development standards and trends.
        • Introduce new technologies and best practices as needed to keep product current.


        Key Qualifications:

        • A great attitude, effective communication skills, and a strong sense of ownership.
        • Ability to work in an entrepreneurial, fast paced, and collaborative environment.
        • A degree in a technical or scientific field; or equivalent experience, education or training.
        • 4+ years of experience writing client-side JavaScript.
        • Expertise with modern web development frameworks and tools (TypeScript, React, Next.js)
        • Experience with testing technologies (Jest, Testing Library, and Cypress or Playwright) 
        • Expertise in building complex layouts with HTML and CSS.
        • Experience working with design software, such as Figma.
        • Familiarity with continuous integration and deployment lifecycles.
        • Knowledge of software engineering best practices using GitHub.
        • Ability to effectively analyze and triage production software problems.


        Bonus Points: 

        • Experience with fp-ts, d3, or Tailwind CSS.
        • Experience working in small startup environments.
        • Passion about making inclusive and accessible interfaces.
        • Experience designing websites or applications.
        • Experience investigating and improving JavaScript performance.


        Why Cape Privacy?


        Cape Privacy is a secure, self-service platform for running AI predictions on encrypted data in Snowflake. Cape’s platform protects security and privacy by default using secure multiparty computation, which keeps data encrypted in-use. This means users can unlock powerful insights from highly confidential data that remains encrypted, providing a more precise understanding of market, customer, and product trends. 


        At Cape, you'll be working on truly novel technology, working with a fast-growing team of cryptographers, machine learning researchers, and software engineers where you can grow your expertise, share knowledge, and keep learning. We take pride in our work; foster a culture of collaboration, integrity, diversity, and humility; practice continuous improvement; and we take great care of our customers.


        Cape, Inc. is based in New York City and Halifax Canada, and is backed by Evolution Equity Partners, Tiger Global Management, Boldstart ventures, Version One Ventures, Ridgeline Partners, Haystack, and Radical Ventures. Visit capeprivacy.com for more information. 

        See more jobs at Cape Inc

        Apply for this job

        +30d

        Senior Backend Developer (PHP)

        CoveSingapore, SG Remote
        Bachelor's degree5 years of experiencewordpresstailwindlaravelDesignapigitmysqlcsslinuxbackendfrontendPHP

        Cove is hiring a Remote Senior Backend Developer (PHP)

        About Cove: Cove is the new way to rent your home! We’re a co-living start-up making it easier and more affordable for young people to have a comfortable place they can call home with a seamless rental experience from end to end. We provide our tenants with stylishly furnished properties, in the most awesome locations in Singapore and Jakarta and make the whole rental process seamless from end to end. Our contract terms are flexible like our tenant’s lives and our rental prices include everything from utilities and wifi and weekly cleaning. What’s unique about Cove is that our tenants get matched with great flatmates and also have access to our community events around the city. Check us out for more exciting information at https://cove.sg.

        At Cove we reward and praise strong performance and strive to produce zero-defect results. We always aim for excellence and to always have the mindset of continuous improvement. In achieving results, we still make work fun and we completely value our team as people, not just resources in which we display care as well as empathy. Celebrating success with our team is also our priority and we highly encourage integrity and transparency.

        Job Title: Senior Backend/Fullstack Developer (PHP)

        Job Type: Permanent (Open to a remote position nearby GMT+8)

        Start Date: ASAP

        Reports To: Head of Engineering

        Role Purpose:This role will support web development initiatives in the Company. We're open to having applications that can work equal to SGT (GMT+08).

        Responsibilities:

        • Develop and maintain our Laravel backend and its integration with the Property Management System
        • Work with external APIs, build and maintain other integrations
          • Collaborate with other Tech team members to design and develop products and features
          • Produce clean and maintainable code

            Requirements:

            • Bachelor's Degree in Computer Science/math
            • 5 years of experience in PHP (PHP 7, Laravel/Symfony)
            • SOLID/KISS/DRY
            • MySQL, Redis
            • Experience in designing and building REST API
              • Unit testing
              • CI/CD, Linux, nginx, git
              • Have systemic thinking, proactivity, ability to work independently, following best practices, curiosity, and desire to constantly learn

              Nice to have:

              • Experience in Frontend (React.js, Next.js, Tailwind CSS)
              • WordPress

              What’s in it for You:

              Working for Cove gives you the opportunity to join an exciting young start-up incubated through Antler.co. In your role, you’ll have the opportunity to hit the ground running and take ownership from day one. We will always welcome your input and ideas and actively encourage your development. The team is fast-paced, hard-working, and expects results but we also highly value our employee engagement and are committed to a human and empathetic environment with plenty of fun thrown in.

              See more jobs at Cove

              Apply for this job

              +30d

              Senior Software Engineer (ReactJS, NextJS)

              vFairsLahore, PK Remote
              agile3 years of experiencetailwindDesignjqueryuihtml5apitypescriptcssAWSjavascriptreduxreactjsfrontend

              vFairs is hiring a Remote Senior Software Engineer (ReactJS, NextJS)

              We are looking for a Senior Software Engineer who can build and extend our virtual event platform & amplify the user experience we deliver to clients. The idea is to keep enhancing our solution with ideas that solve challenging problems our customers face during events.

              This is going to be a high-impact role where the deliverable will be used by thousands of users upon release. You will be required to implement software that is accurate, fast, thoughtful, and scalable.

              In this role, you’ll be required to understand business goals and road maps from customers/product managers. You will then select the best approach to solve the problem in a generic way that naturally extends the product and implements a solution. We entrust ownership to our developers and let them run with creative ideas. We also have a development team across Lahore and Dubai that you can look forward to for help and guidance.

              Roles & Responsibilities

              • Work with design, product management, and development teams to create elegant, interactive, and highly performant interfaces and tools by using modern technologies and solutions
              • Integrate HTML and front-end deliverables
              • Produce clean, efficient code based on specifications & customer requirements
              • Estimating the development efforts required and chasing weekly / monthly targets.
              • Follow best practices of SDLC, Programming, Change control, and Code reviews
              • Optimize application for maximum speed and scalability
              • Create technical documentation for reference and reporting
              • Creation & execution of unit tests for TDD using automated testing frameworks.
              • Work with development, staging, and production environments seamlessly
              • Collaboration with project/product management teams and other stakeholders
              • Troubleshoot, debug and upgrade existing software

              Qualification & Experience

              • BS / MS in Computer Science/IT or relevant degree
              • Minimum 3 years of experience with ReactJS and NextJS
              • Relevant certifications will be a plus

              Skills

              • Experienced with application frontend development experience with ReactJS and web apps.
              • Experienced with Material UI, Tailwind CSS, JavaScript, HTML5, CSS3, and Bootstrap.
              • Proficient understanding of client-side scripting and JavaScript frameworks including jQuery
              • Solid understanding of HTTP protocols, AJAX, REST, JSON
              • Knowledge of TypeScript, TDD, Redux
              • Experienced with 3rd Party API implementation and integrations
              • Sound knowledge of code versioning tools such as GitHub/GitLab
              • Good knowledge of AWS (EC2, S3, Lambda, etc.) will be a plus point
              • Familiarity with Agile development methodologies and tools
              • Willingness to work with new technologies and explore them for project benefits.
              • Ability to work independently and in teams
              • Values a culture of mentorship and learning
              • Good spoken & written communication skills
              • Excellent analytical and problem-solving skills
              • Able to work in a fast-paced and challenging environment
              • Ability to work under pressure and to tight deadlines
              • Flexibility in multiple time zone coverage

              See more jobs at vFairs

              Apply for this job

              +30d

              Software Quality Assurance Engineer

              4 years of experiencewordpresstailwindDesignmobilescrumqarubymysql

              PWV Consultants is hiring a Remote Software Quality Assurance Engineer

              Software Quality Assurance Engineer - PWV Consultants - Career Page

              See more jobs at PWV Consultants

              Apply for this job