tailwind Remote Jobs

57 Results

20d

Senior React Native Developer

CoveSingapore, SG Remote
2 years of experience5 years of experiencefigmasketchtailwindDesignmobilecssfrontend

Cove is hiring a Remote Senior React Native Developer

About Cove: Cove is the new way to rent your home! We’re Southeast Asia’s leading branded home rental start-up making it easier, faster, and more flexible to rent comfortable homes at honest prices. In 2021 we’ve grown over 300% and have now housed over 1500 tenants across Singapore and Indonesia. Cove tenants get stylishly furnished properties, in the most awesome locations and we make their whole rental experience seamless from end to end. Our contract terms are flexible like our tenant’s lives and our rental prices include everything from utilities and wifi to weekly cleaning. All our tenants get access to our community events and perks around the city and can network with other Coveys through our community app. We are backed by strong global investors including Keppel Land, Idinvest, Picus Capital, Venturra and Xander and have raised over US$6M in funding to date. Please join us on this home rental revolution and help us realize our vision to provide millions of better homes to young people across Southeast Asia. Check us out at cove.sg or cove.id.

At Cove we reward and praise strong performance and strive to produce zero-defect results. We always aim for excellence and to always have the mindset of continuous improvement. In achieving results, we still make work fun and we completely value our team as people, not just resources in which we display care as well as empathy. Celebrating success with our team is also our priority and we highly encourage integrity and transparency.

Job Title: Senior React Native Developer

Job Type: Full-time Remote

Reports To: Head of Engineering

Role Responsibilities: Lead the new mobile app development. We're open to have someone working remotely close to Singapore Time (GMT+8)

Main Responsibilities:

  • Design and build new cross-platform mobile app;
  • Be responsible for the full product cycle from designing stage to publishing to the stores;
  • Collaborate and help the frontend team (Next.js)

Experience and Qualifications Required:

  • 5 years of experience as a Frontend Developer
  • 2 years of experience as a React Native Developer
  • Deep understanding of JavaScript/Typescript and React
  • Understanding of SOLID, KISS, DRY principle
  • Experienced in doing Unit Testing
  • Good English, both written and spoken
  • Attention to detail, ability to work independently
  • Had published apps in stores

Nice to have Qualifications:

  • Experienced in prototyping (Figma, Sketch, Framer, etc.)
  • Experience in Swift/Objective-C/Java/Kotlin
  • Experience in Redux/MobX
  • Experience in Next.js and Tailwind CSS

What’s in it for You: Join us and you’ll be surrounded by our three inspiring co-founders: Sophie, Luca, and Guillaume. You’ll also be working directly with them and get to experience first-hand what it takes to get a new high-growth business off the ground. Working for Cove gives you the opportunity to learn in an exciting young startup incubated through Antler. Co and take ownership from day one. The team is fast-paced but you can expect a highly-supportive environment where your voices will be heard and appreciated at all times. We are hard-working and expect results but definitely value employee engagement as well as committed to creating a human and empathetic environment. We actively encourage your development to help become a better you with plenty of fun thrown in.

See more jobs at Cove

Apply for this job

24d

Frontend Engineer - Growth (Storefronts)

ProtonMailLondon, Geneva, Zürich, Prague, Vilnius, Barcelona;, Switzerland, Remote
tailwindDesignmetalcssjavascriptfrontend

ProtonMail is hiring a Remote Frontend Engineer - Growth (Storefronts)

At Proton, we envision an internet where privacy is the default, and we’re building ways to help all people secure their digital lives and take control of their data. Proton was founded in 2014 by a group of scientists who met at the European Organization for Nuclear Research (CERN). And since its inception, the company has grown at a fast pace and today has over 40 million users.

Our principal product, Proton Mail, is the world’s largest secure email service. Our second product, Proton VPN, is one of the world’s most popular VPN services. Our vision is to build an internet platform for the protection of digital rights, and we are also developing additional products, including Proton Calendar, Proton Drive, and more to come.

Our users include New York Times journalists, some of the world’s largest corporations, and millions of ordinary citizens. The world is adopting our products at an accelerating pace. Whether it’s in New York, or at the front lines of the global struggle for freedom and democracy in Hong Kong, Belarus, and Myanmar, the work we do saves lives and is transforming the world. Our team is diverse and dynamic, representing over 30 different nationalities, with offices in Geneva, Zurich, Prague, London, Vilnius, Skopje, and Taipei, employing people around the world.

Proton is a mission driven company. We’re deeply committed to enabling freedom online and ensuring the internet serves the interests of all people. Our technologies provide trusted ways for people to be secure online and in control of their information at all times. The world is adopting our products at an accelerating pace. Help us bring it from tens of millions of users, to billions of users. We’re creating one of the world’s most impactful tech companies.

Purpose of the role

Growth Engineering is a rapidly growing team at Proton. Our engineering excellence drives the acquisition, onboarding, activation, and engagement of Proton customers. We are focused on delivering a high-quality, performant, and accessible experience to our users.



What you will do

  • Join an existing team within Growth Engineering, working closely with teammates in order to design, build, test, and optimize our websites and web properties.
  • Develop high-quality customer experiences on the web.
  • Write readable, maintainable, tested, and well-documented code.
  • Ensure that acceptance criteria and all parts of the technical design are correctly incorporated.
  • Follow and promote engineering best practices.
  • Take part in team activities, such as sprint ceremonies, code reviews, and pair programming.
  • Share your unique knowledge and skills with the rest of the team.

    See more jobs at ProtonMail

    Apply for this job

    25d

    UI Developer (f/m/d) - GER, UK, NL, PL

    DeepL sucht MitarbeiterRemote job, Remote
    agiletailwindDesignsassuiUXtypescriptcssjavascriptfrontend

    DeepL sucht Mitarbeiter is hiring a Remote UI Developer (f/m/d) - GER, UK, NL, PL

    is Germany's best-known AI company. We develop neural networks to help people work with language. With DeepL Translator, we have created the world's best machine translation system and made it available free of charge to everyone online. Over the next few years, we aim to make DeepL the world's leading language technology company.

    Our goal is to overcome language barriers and bring cultures closer together.
     

    What distinguishes us from other companies?

    DeepL (formerly Linguee) was founded by developers and researchers. We focus on the development of new, exciting products, which is why we spend a lot of time actively researching the latest topics. We understand the challenges of developing new products and try to meet them with an agile and dynamic way of working. Our work culture is very open because we want our employees to feel comfortable. In our daily work we use modern technologies - not only to translate texts, but also to create the world's best dictionaries, and solve other language problems.
    When we tell people about DeepL as an employer, reactions are overwhelmingly positive. Maybe it's because they have enjoyed our services, or maybe they just want to get on board with our quest to break down language barriers and facilitate communication.


    Your choice

    We are constantly looking for outstanding employees! Currently we offer remote work in Germany, the Netherlands, the UK and Poland. Whether you would like to work from home in one of these countries or from one of our offices in Amsterdam, London, Cologne or Paderborn: the choice is yours. No matter where you choose to work from, our way of working is designed to make you an essential part of the team. 


    What will you be doing at DeepL?

    Thanks to our unique neural networks, DeepL is able to deliver the world’s best translation quality. In order to keep it that way, we are constantly improving our apps and adding exciting new features - and this is where your experience in developing great interfaces comes in: our products only really shine and help our users when they are presented well. In addition to the classic challenges of frontend development such as UX design, we are particularly interested in your ability to build functional (and pretty) UIs and your knowledge of CSS and current related technologies. You will be part of a highly motivated team that values top quality and efficient code. Important design decisions are made by the whole team in open discussions.

    See more jobs at DeepL sucht Mitarbeiter

    Apply for this job

    +30d

    Full Stack Software Engineer

    sqltailwindlaravelDesignvuemobilemongodbscrumreact-nativepostgresqlmysqllinuxAWSjavascriptPHP

    SportsRecruits is hiring a Remote Full Stack Software Engineer

    About SportsRecruits

    SportsRecruits is the platform that provides clubs, student-athletes and their families access to every college coach in the country. Club and high school organizations use our platform to empower their student-athletes in the recruiting process and oversee their efforts and communication with complete transparency. Connections made on the platform have resulted in commitments to the best academic and athletic institutions across the country.

     

    SportsRecruits is an equal opportunity employer and embraces diversity and equal opportunity on our team. Just like the student-athletes we support, we are trying to get better and stronger as a team everyday. We are committed to building a team that represents a variety of backgrounds, perspectives, and skills. We truly believe that the more inclusive our team is, the better we can serve all student-athletes, as well as their families and coaches, who are pursuing their dreams.

     

    About the Team

    We are a product development team full of fun, intelligent, happy, and hardworking engineers, designers and product managers distributed across the United States. We are profitable, funded and giving more high school athletes the ability to play college athletics than any other recruiting tool out there. Your input and coding/problem solving skills will make a direct impact in how we scale and grow the company.  

     

    About the Position

    We are looking for a senior front-end developer that will take ownership of maintaining and building new Javascript components, profiling front-end application performance, instilling best practices, mentoring and learning with other engineers, and working with the design team to iterate on our digital design system, style guide, and application user interface.  

    This role will guide the front-end development for all client-facing digital products including websites, mobile apps, and other software efforts.

    This position will be reporting to the Director of Product Engineering. This is a remote role on a remote team working across the United States. If you are located in NYC, you will have the option to go into our downtown Manhattan Wework office if you choose to. 

    You will contribute to solving complex problems that will make our platform even better at connecting thousands of student athletes and college programs. Some interesting projects we’ve recently worked on are:

    • In-browser video clipping and editing for making highlight reels 
    • Robust player search and matching for college coaches 
    • React-native based hybrid iOS/Android app for recruiting events scheduling
    • Tools for partner events to import rosters of athletes with built-in column mapping, de-duping and validation rules to automatically merge duplicate user data 

     

    About you:

    • Several years as a professional software developer with experience in 2+ languages
    • Experience in one or more modern MVC frameworks (e.g. Laravel, Rails, Django)
    • Stack alignment isn’t a requirement, but you have the ability to learn and adapt to our tech stack: Vue / Laravel / React Native
    • Built high-quality, performant, maintainable software incrementally and pragmatically
    • Used context-appropriate automated testing to inform software design choices and increase confidence in deliverables and refactoring
    • Debugged, tested, and refactored pre-existing code to incrementally improve it
    • Understands cross-browser issues and debugging
    • Passionate about Object-Oriented Design & clean code
    • Has experience working with relational databases (MySql, SQL Server, Postgresql)

     

    Nice to have:

    • Experience with Laravel / Vue / Tailwind
    • DevOps / Ops / Linux / AWS experience
    • Scrum / XP / Kanban experience
    • PHP knowledge / experience
    • Experience working with 3rd party APIs
    • MySql / Redis / MongoDB experience
    • In-depth knowledge of testing and TDD

    Personal:

    • Mentored and shared knowledge with colleagues, adapted to suggestions, made thoughtful recommendations to your team, and worked collaboratively
    • Independent, self-motivated, inquisitive
    • Growth-oriented mindset: consistently learning and experimenting with new ideas, techniques, and paradigms; seeks out feedback
    • Proactive and positive attitude

    Perks:

    • Unlimited PTO through our “Personal Responsibility Vacation Policy”
    • Health/Dental/Vision insurance
    • Start to finish project ownership
    • Travel to NYC a few times per year for team building events

     

    See more jobs at SportsRecruits

    Apply for this job

    +30d

    Product Marketing Lead

    PopSQLRemote
    terraformsqltailwindDesigngraphqluiapiUXpostgresqltypescriptcssAWSjavascriptbackendfrontend

    PopSQL is hiring a Remote Product Marketing Lead

    Product Marketing Lead at PopSQL (S19)
    SQL editor for teams
    Remote / Remote
    Full-time
    About PopSQL

    Every company wants to use data to make informed decisions, and SQL is the lingua franca for data. However, data collaboration is broken. People are rewriting each other's queries, switching apps to visualize their data, and copying/pasting SQL into Slack.

    PopSQL solves this by creating a beautiful, fun way to write SQL, visualize data, and share results. The product is loved by data teams from over 2000 companies including DoorDash, Shipt, Redfin, and Optimizely. What we've built so far is just the beginning. Join us and build a great product, a great culture, and a great company ????

    About the role

    About PopSQL

    Every company wants to use data to make informed decisions, and SQL is the lingua franca for data. However, data collaboration is broken. People are rewriting each other's queries, switching apps to visualize their data, and copying/pasting SQL into Slack.

    PopSQL solves this by creating a beautiful, fun way to write SQL, visualize data, and share results. The product is loved by data teams from over 2,000 companies including Target, Redfin, and Udacity. What we've built so far is just the beginning. Join us and build a great product, a great culture, and a great company ????

    About the role

    • Create and execute PopSQL’s go-to-market strategy across self-service and sales assisted motions in partnership with product, sales, and customer success. Quarterback marketing activities across different stages of the marketing funnel by helping identify areas of focus and opportunity. 

    • Distill and communicate the value prop of PopSQL in the minds of our prospects and customers by analyzing the market and competitive landscape, crafting our positioning and messaging, and blending it in with a knack for great storytelling.

    • Direct and sequence product/feature announcements, enabling our customer facing team with the right mix of programs, assets and collateral to not just nail the product launch, but also the “landing” aka supporting go-to-market activities post launch.

    • Partner with and enable growth marketing, content/customer marketing, and sales to tell our product narrative with one authentic voice. Done right, product marketing is the messaging API for the rest of the company.

    About you

    • 6+ years of experience in SaaS/PaaS/Dev Tool product marketing or related roles. 

    • A passion for storytelling. You can simplify the complex, take data science concepts and challenges (working with our subject matter experts) and make them “Sesame Street” simple. 

    • Experience working directly with technical stakeholders and sales leadership and providing them with the right level of guidance, market context and competitive intelligence to drive consensus and reach key go-to-market decisions. You are equally comfortable acting as the product whisperer as you are being sales’ best friend.

    • You enjoy engaging directly with customers, learning how we can improve their experiences, and embody customer-centricity in everything you do.

    • Excellent communication skills, both oral and written, including the ability to present complex material to customers, press, and analysts in a compelling way

    • A desire to join a team to build a company, do great work with great people and have fun while doing it.

    Benefits

    • Competitive salary and equity

    • 100% medical, dental, and vision insurance for you and your family

    • 401k

    • Life insurance

    • Flexible working schedule and unlimited vacation policy

    • MacBook Pro or equivalent 

    • Company retreats 2-3 times per year

    Location

    Our team is spread throughout the Americas. You're free to choose your own hours and schedule your day in such a way that creates work-life harmony.

    Technology

    Frontend

    • React application using hooks written in JavaScript and a bit of TypeScript
    • Apollo to fetch data from our GraphQL API
    • Storybook component library
    • Electron to power our cross platform desktop application
    • Next.js to build server side rendered static sites
    • Tailwind CSS

    Backend

    • Rails hosted on AWS ECS
    • GraphQL API
    • PostgreSQL for our primary data store, Redis and Memcached for caching
    • Terraform for infrastructure as code

    Practices

    • We love to weave testing, analytics, logging, monitoring, and alerting into our projects
    • Continuous integration/delivery
    • GitHub pull requests/code reviews
    • Quick daily synchronous product meetings to demo progress and get rapid feedback from your peers
    Apply Now

    See more jobs at PopSQL

    Apply for this job

    +30d

    Growth Marketing Lead

    PopSQLRemote
    terraformsqltailwindDesigngraphqluiapiUXpostgresqltypescriptcssAWSjavascriptbackendfrontend

    PopSQL is hiring a Remote Growth Marketing Lead

    Growth Marketing Lead at PopSQL (S19)
    SQL editor for teams
    Remote / Remote
    Full-time
    About PopSQL

    Every company wants to use data to make informed decisions, and SQL is the lingua franca for data. However, data collaboration is broken. People are rewriting each other's queries, switching apps to visualize their data, and copying/pasting SQL into Slack.

    PopSQL solves this by creating a beautiful, fun way to write SQL, visualize data, and share results. The product is loved by data teams from over 2000 companies including DoorDash, Shipt, Redfin, and Optimizely. What we've built so far is just the beginning. Join us and build a great product, a great culture, and a great company ????

    About the role

    About PopSQL

    Every company wants to use data to make informed decisions, and SQL is the lingua franca for data. However, data collaboration is broken. People are rewriting each other's queries, switching apps to visualize their data, and copying/pasting SQL into Slack.

    PopSQL solves this by creating a beautiful, fun way to write SQL, visualize data, and share results. The product is loved by data teams from over 2,000 companies including Target, Redfin, and Udacity. What we've built so far is just the beginning. Join us and build a great product, a great culture, and a great company ????

    About the role

    • Craft and execute PopSQL’s demand generation strategy across digital marketing campaigns and programs to generate leads and grow pipeline.

    • Embrace product-led growth (PLG) techniques to understand and improve our conversions across all customer touchpoints–from top to bottom of the marketing funnel to stages of the user journey (i.e. activation, adoption, retention and advocacy).

    • Partner with sales and product on metering and measuring success, improving lead scoring and enabling seamless handoffs between marketing, sales and customer success. 

    • Build a world-class marketing tech stack that supports our self-service and sales-assisted motions, while putting us on the map as experts on what modern, growth marketing looks like in the data science space.

    About you

    • 6+ years of experience running growth marketing, demand generation, digital and lifecycle marketing at SaaS/Dev Tool companies. Hypergrowth experience is a plus.

    • Battle-tested knowledge across a variety of growth channels: SEO, paid ads, content marketing, email, community building, social media, etc. Much of our growth has been organic to date, and we’re looking to identify the areas of investment that will help accelerate it. You can direct our team go deep on certain tactics, while leveraging and managing vendors to execute across others. 

    • Experience with PLG, freemium/free trial, and/or hybrid (top down + bottom up) models.

    • A knack for wrangling data and analytics to uncover insights, testing hypotheses, and reporting results.

    • Always be experimenting. You will encourage us to quickly test and iterate across tactics to pinpoint where we can maximize our efforts. 

    • A desire to join a team to build a company, do great work with great people and have fun while doing it.

    Benefits

    • Competitive salary and equity

    • 100% medical, dental, and vision insurance for you and your family

    • 401k

    • Life insurance

    • Flexible working schedule and unlimited vacation policy

    • MacBook Pro or equivalent 

    • Company retreats 2-3 times per year

    Location

    Our team is spread throughout the Americas. You're free to choose your own hours and schedule your day in such a way that creates work-life harmony.

    Technology

    Frontend

    • React application using hooks written in JavaScript and a bit of TypeScript
    • Apollo to fetch data from our GraphQL API
    • Storybook component library
    • Electron to power our cross platform desktop application
    • Next.js to build server side rendered static sites
    • Tailwind CSS

    Backend

    • Rails hosted on AWS ECS
    • GraphQL API
    • PostgreSQL for our primary data store, Redis and Memcached for caching
    • Terraform for infrastructure as code

    Practices

    • We love to weave testing, analytics, logging, monitoring, and alerting into our projects
    • Continuous integration/delivery
    • GitHub pull requests/code reviews
    • Quick daily synchronous product meetings to demo progress and get rapid feedback from your peers
    Apply Now

    See more jobs at PopSQL

    Apply for this job

    +30d

    Content and Customer Marketing Manager

    PopSQLRemote
    terraformsqlB2BtailwindDesigngraphqluiapiUXpostgresqltypescriptcssAWSjavascriptbackendfrontend

    PopSQL is hiring a Remote Content and Customer Marketing Manager

    Content and Customer Marketing Manager at PopSQL (S19)
    SQL editor for teams
    Remote / Remote
    Full-time
    About PopSQL

    Every company wants to use data to make informed decisions, and SQL is the lingua franca for data. However, data collaboration is broken. People are rewriting each other's queries, switching apps to visualize their data, and copying/pasting SQL into Slack.

    PopSQL solves this by creating a beautiful, fun way to write SQL, visualize data, and share results. The product is loved by data teams from over 2000 companies including DoorDash, Shipt, Redfin, and Optimizely. What we've built so far is just the beginning. Join us and build a great product, a great culture, and a great company ????

    About the role

    About PopSQL

    Every company wants to use data to make informed decisions, and SQL is the lingua franca for data. However, data collaboration is broken. People are rewriting each other's queries, switching apps to visualize their data, and copying/pasting SQL into Slack.

    PopSQL solves this by creating a beautiful, fun way to write SQL, visualize data, and share results. The product is loved by data teams from over 2,000 companies including Target, Redfin, and Udacity. What we've built so far is just the beginning. Join us and build a great product, a great culture, and a great company ????

    About the role

    • Create and maintain PopSQL’s editorial calendar and curate all content channels (including blog, newsletters, social media channels) with the goal of informing customers and delighting our broader community with a steady stream of engaging and thoughtful content.

    • Give a voice to our customers and their successes by giving life to our very first customer program. Cultivate and work with them to share their stories in original and compelling ways.

    • Help us establish an original point-of-view in the market that cements our category position, empowers our customers, excites prospects and partners, and helps attract the best new talent.

    • Partner with product marketing, product and customer success to research, outline, and produce original persona-targeted materials and tactics that fuel break-through marketing campaigns.

    • Track and report results across content channels with the goal of continuously identifying areas for improvement and investment. 

    About you

    • 4+ years experience owning content and/or customer marketing at fast-growing SaaS companies

    • Excellent communication and writing skills, with the ability to craft a compelling story. At PopSQL, we’re looking to help business teams break down silos and answer their most critical business questions faster, together. A good story is a good platform and a good platform is a good story.  

    • A passion for evangelizing how the right technologies can help business teams achieve what previously wasn’t attainable.

    • A vision on how to leverage data, research, industry trends and agencies matched with the ambition to create a B2B content-machine for the ages.

    • Familiarity with the data/business intelligence space PopSQL operates in

    • An owner, customer-whisperer who can execute in fast paced environments

    • A desire to join a team to build a company, do great work with great people and have fun while doing it.

    Benefits

    • Competitive salary and equity

    • 100% medical, dental, and vision insurance for you and your family

    • 401k

    • Life insurance

    • Flexible working schedule and unlimited vacation policy

    • MacBook Pro or equivalent 

    • Company retreats 2-3 times per year

    Location

    Our team is spread throughout the Americas. You're free to choose your own hours and schedule your day in such a way that creates work-life harmony.

    Technology

    Frontend

    • React application using hooks written in JavaScript and a bit of TypeScript
    • Apollo to fetch data from our GraphQL API
    • Storybook component library
    • Electron to power our cross platform desktop application
    • Next.js to build server side rendered static sites
    • Tailwind CSS

    Backend

    • Rails hosted on AWS ECS
    • GraphQL API
    • PostgreSQL for our primary data store, Redis and Memcached for caching
    • Terraform for infrastructure as code

    Practices

    • We love to weave testing, analytics, logging, monitoring, and alerting into our projects
    • Continuous integration/delivery
    • GitHub pull requests/code reviews
    • Quick daily synchronous product meetings to demo progress and get rapid feedback from your peers
    Apply Now

    See more jobs at PopSQL

    Apply for this job

    +30d

    Backend Laravel PHP Web Engineer

    Blue Ocean IdeasTowson, MD Remote
    tailwindlaravelgitmysqltypescriptcsskubernetesbackendfrontendPHP

    Blue Ocean Ideas is hiring a Remote Backend Laravel PHP Web Engineer

    We're looking for someone with very strong back-end skills who is an expert in Laravel. You will be working on a recently launched large association management platform built from the ground up with modern techniques in Laravel.

    About You

    You're a strong problem solver who loves to learn — we're not experts in everything and we don't expect you to be either.

    You are passionate about building great software. Quality is very important to you. You understand the value of testing: unit tests, integration tests, performance tests, etc.

    We don't care if you went to school, we just care about what you can do and how you do it. We're all just makers and tinkerers, so as long as you love to build awesome stuff you'll fit right in.

    What you’ll need

    • Strong experience building complex applications with Laravel.
    • Experience writing tests and using PHPUnit.
    • Strong experience with Git and working with a team using code version control.
    • You've worked on large-scale web applications.
    • Knowledge of React is a plus.

    Our Technology Stack

    • Backend
      • PHP
      • Laravel
      • MySQL
      • Redis
      • Algolia
      • Pusher
    • Frontend
      • React / Intertia.js / TypeScript
      • Tailwind CSS
      • Blade
    • Devops:
      • Octane
      • Kubernetes
      • FluxCD

    About Us

    Blue Ocean Ideas solves problems with Truth, Goodness, and Beauty. We’re building the next generation of Association Management Software. We look for team members exhibiting our virtues, core competencies, and role competencies in their domain.

    Our Virtues

    • Wisdom – Knowing how to act in any situation
    • Fortitude – Showing strength and courage
    • Temperance – Exhibiting moderation
    • Justice – Treating everyone equitably
    • Faith – Believing in the best of people and situations
    • Hope – Seeing a bright future and moving toward that future
    • Love – Acting for the benefit of others

    Our Core Competencies

    • Simplify: Things should be made as simple as possible, but no simpler
    • Organize: Things are in order consistently
    • Anticipate: Sees the future and adjusts accordingly
    • Communicate: Clear, forthright, open, honest

    Benefits

    • 401k
    • Flexible time off policy
    • Health insurance (HSA with compatible plans)
    • Dental insurance
    • Vision insurance
    • Life insurance
    • Long-term disability insurance
    • Apple MacBook Pro + second screen

    See more jobs at Blue Ocean Ideas

    Apply for this job

    +30d

    Engineering Manager - Growth

    ProtonMailLondon, Geneva, Zürich, Prague, Vilnius, Barcelona;, Switzerland, Remote
    sqltailwindDesignmetalsasssymfonymysqlcssjavascriptPHP

    ProtonMail is hiring a Remote Engineering Manager - Growth

    At Proton, we envision an internet where privacy is the default, and we’re building ways to help all people secure their digital lives and take control of their data. ProtonMail was founded in 2014 by a group of scientists who met at the European Organization for Nuclear Research (CERN). And since its inception, the company has grown at a fast pace and today has over 40 million users.

    Our principal product, ProtonMail, is the world’s largest secure email service. Our second product, ProtonVPN, is one of the world’s most popular VPN services. Our vision is to build an internet platform for the protection of digital rights, and we are also developing additional products, including ProtonCalendar, ProtonDrive, and more to come.

    Our users include New York Times journalists, some of the world’s largest corporations, and millions of ordinary citizens. The world is adopting our products at an accelerating pace. Whether it’s in New York, or at the front lines of the global struggle for freedom and democracy in Hong Kong, Belarus, and Myanmar, the work we do saves lives and is transforming the world. Our team is diverse and dynamic, representing over 30 different nationalities, with offices in Geneva, Zurich, Prague, London, Vilnius, Skopje, and Taipei, employing people around the world.

    Proton is a mission driven company. We’re deeply committed to enabling freedom online and ensuring the internet serves the interests of all people. Our technologies provide trusted ways for people to be secure online and in control of their information at all times. The world is adopting our products at an accelerating pace. Help us bring it from tens of millions of users, to billions of users. We’re creating one of the world’s most impactful tech companies.

    Purpose of the role
    As a leader within the Growth Engineering team, you will manage a cross-functional team of engineers that has direct responsibility of reaching millions of new customers and onboarding them into our product ecosystem. You will lead design and development of systems pertaining to acquisition, onboarding, activation, and engagement while creating great user experiences at scale. As a member of the Growth leadership team you will partner with Product and Marketing to refine our growth strategies, design experiments that discover and validate customer hypotheses, and optimize our customer experiences to drive engagement and keep our existing customers happy. You will report directly to the VP of Engineering.


    What you will do

    • Collaborate with senior leadership and your peers to develop the strategy for your team
    • Lead and participate in technical design and product discussions with leaders across the company
    • Hire, develop, and coach engineers, and help them learn and grow to achieve their goals
    • Hold yourself and your team accountable to high engineering standards
    • Guide your team to continuously improve our systems towards greater observability and resiliency
    • Develop efficient processes, instill a sense of urgency, and motivate your team to operate with high velocity, ownership, and accountability
    • Build products, systems, and services that solve your customers' problems
    • Foster an inclusive environment for your team to show up and give their best each day
    • Contribute to the broader technology and open source communities


    Technologies we use and teach

    • Javascript, React, Gatsby
    • PHP, Symfony
    • SQL, MySQL, Kafka, Redis
    • Event driven architecture

      See more jobs at ProtonMail

      Apply for this job

      +30d

      Principal Engineer

      tailwindDesignmobilemongodbuiUXqaflutterpostgresqlAWSjavascriptreactjsbackendfrontendNode.js

      Clipboard Health is hiring a Remote Principal Engineer

      Principal Engineer at Clipboard Health (W17)
      $80k - $150k  •  
      Connects healthcare facilities with nurses nearby.
      Remote
      Full-time
      6+ years
      About Clipboard Health

      At Clipboard Health (YC W17) we work with healthcare facilities such as hospitals, assisted living facilities, and rehab centers to provide on-demand nursing staff. We are a fully remote team that is humble and hardworking. We think this is the best way to improve a ton of lives. Nurses will have better schedules and shorter commutes, and patients will receive better care.

      About the role

      Skills: JavaScript, Node.js, React

      Why Clipboard Health Exists

      We exist to lift as many people up the socioeconomic ladder as possible. The average nursing assistant without a college degree makes $36k a year; the average nursing assistant on Clipboard Health makes $53k a year and the top 5% make $74k a year. We dramatically improve lives, by letting healthcare professionals turn extra time & ambition into career growth. We have healthcare professionals texting us photos of a car they were finally able to buy, a school & church they’re building in their native Haiti with money they earn here, and more.

      We’re a post Series B, an extremely fast-growing startup with classic two-sided network effects. We’ve grown 6x (across all key metrics) in the last 11 months and need your help to keep growing to serve more healthcare professionals, healthcare facilities, and patients.

      What’s weird about working with us?

      • We care, a lot. Our CEO spends substantial time regularly doing customer service, and many of our healthcare professionals and healthcare facility clients have her personal cell phone number.
      • We are globally distributed. Just on the engineering team, we have folks from the United States, Chile, Mongolia, Turkey, India, Ukraine, Indonesia, Brazil, Columbia… and that’s just from folks who’ve joined us so far this year.
      • We take our values seriously: our COO literally has a handmade Curiosity Initiative and Ownership sign on his wall (you’ll see it if you video call him).
      • We have more engineers than we “need” on purpose. It makes us fast (many features go from idea to production in 2-4 weeks). It also allows small teams to see a problem, and just go fix it. A team went off and created a new SaaS product, another team rewrote a core service under a new architecture.
      • One thing we value is that we have no “toes” here to be stepped on. See a problem? Go ahead and fix it, you don’t need permission.

      You’re good at:

      • Scalable/high-performance code on both the frontend and backend, understanding complex technical areas along the way.
      • Efficient and reusable systems that drive complex web and mobile applications.
      • Creating software features that are robust, reliable, and user-friendly for both internal teams and our customer base.
      • Running the full software development lifecycle - problem definition, design, development, testing, demoing, and supporting production use of the features you own.
      • Balancing immediate business objectives against the long-term architectural vision.

      Extra Awesome if you are:

      • A fan of the speed of startups, having worked at one or more (including maybe your own) before.
      • Familiar with modern open source technologies like: Next.js (Express.js/React), Tailwind UI, Flutter, PostgreSQL, MongoDB, Docker.
      • Experienced in developing REST APIs, mobile & web apps that interface with said APIs, on AWS (or similar).

      Perks of Working with us:

      • Do great work that matters, in healthcare, for customers who could really use your help
      • Zero commute. Work wherever you are, globally (but on or around US Pacific Time hours)
      Technology

      ReactJS Node.js Javascript Ionic Mongo

      See more jobs at Clipboard Health

      Apply for this job

      +30d

      Permanent Job: Full Stack PHP Developer with Laravel - Remote

      BeyPark St, Jersey City, NJ 07304, USA, Remote
      tailwindlaravelvuesassiosgitandroiddockermysqlcsslinuxangularAWSjavascriptfrontendPHP

      Bey is hiring a Remote Permanent Job: Full Stack PHP Developer with Laravel - Remote

      Job Description

      Title: Full Stack PHP Developer

      Type: Fulltime

      Location: Remote

      Salary Range: DOE

      The Role:Client is looking to add a remote developer to its team to help us increase our ability to deliver more projects quickly while retaining the ability to maintain the website and improve site performance.

      Minimum 4 years’ experience with: PHP 7.x, Developing applications with Laravel, Working with a frontend JavaScript framework, Working knowledge of Git / GitHub, MySQL,

      Preferred experience in:Vue JS, Angular, Elastic Search & Algolia, Sass, Webpack / Gulp

      Bonus points:Tailwind CSS, Test-driven development, GitHub Actions, React Native, iOS / Android app development experience, Contributions to Open Source, Docker, Basic DevOps knowledge (AWS, Linux, Nginx)

      Additional Information

      All your information will be kept confidential according to EEO guidelines.

      See more jobs at Bey

      Apply for this job

      +30d

      Senior Backend/Fullstack Developer (PHP)

      CoveSingapore Remote
      Bachelor's degree3 years of experiencewordpresstailwindlaravelDesignapigitmysqlcsslinuxfrontendPHP

      Cove is hiring a Remote Senior Backend/Fullstack Developer (PHP)

      About Cove: Cove is the new way to rent your home! We’re a co-living start-up making it easier and more affordable for people to rent rooms. We provide our tenants with stylishly furnished properties, in the most awesome locations in Singapore and Jakarta and make the whole rental process seamless from end to end. Our contract terms are flexible like our tenants’ lives and our rental prices include everything from utilities and wifi and weekly cleaning. Our tenants get matched with great flatmates and also have access to our community events around the city. Check us out at cove.sg or cove.id.

      Job Title: Senior Backend/Fullstack Developer (PHP)

      Job Type: Permanent (Open to a remote position nearby GMT+8)

      Start Date: ASAP

      Reports To: Head of Engineering

      Role Purpose:This role will support web development initiatives in the Company. We're open to having applications that can work equal to SGT (GMT+08).

      Responsibilities:

      • Develop and maintain current and legacy backends (Laravel, WordPress)
      • Collaborate with other Tech team members to design and develop products
      • Work with external APIs, build and maintain integrations
      • Produce clean and maintainable code

        Requirements:

        • Bachelor's Degree in Computer Science/math
        • 3 years of experience in PHP (PHP 7, Laravel/Symfony)
        • SOLID/KISS/DRY
        • MySQL, Redis
        • Experience in building REST API
          • Unit testing
          • CI/CD, Linux, nginx, git
          • Have systemic thinking, proactivity, ability to work independently, following best practices, curiosity, and desire to constantly learn

          Nice to have:

          • Laravel
          • Experience in Frontend (React.js, Next.js, Tailwind CSS)
          • WordPress

          What’s in it for You:

          Working for Cove gives you the opportunity to join an exciting young start-up incubated through Antler.co. In your role, you’ll have the opportunity to hit the ground running and take ownership from day one. We will always welcome your input and ideas and actively encourage your development. The team is fast-paced, hard-working, and expects results but we also highly value our employee engagement and are committed to a human and empathetic environment with plenty of fun thrown in.

          See more jobs at Cove

          Apply for this job

          +30d

          Full Stack PHP Developer with Laravel - Remote Job

          BeyPark St, Jersey City, NJ 07304, USA, Remote
          tailwindlaravelvuesassiosgitandroiddockermysqlcsslinuxangularAWSjavascriptfrontendPHP

          Bey is hiring a Remote Full Stack PHP Developer with Laravel - Remote Job

          Job Description

          Title: Full Stack PHP Developer

          Type: Fulltime

          Location: Remote

          Salary Range: DOE

          The Role:Client is looking to add a remote developer to its team to help us increase our ability to deliver more projects quickly while retaining the ability to maintain the website and improve site performance.

          Minimum 4 years’ experience with: PHP 7.x, Developing applications with Laravel, Working with a frontend JavaScript framework, Working knowledge of Git / GitHub, MySQL,

          Preferred experience in:Vue JS, Angular, Elastic Search & Algolia, Sass, Webpack / Gulp

          Bonus points:Tailwind CSS, Test-driven development, GitHub Actions, React Native, iOS / Android app development experience, Contributions to Open Source, Docker, Basic DevOps knowledge (AWS, Linux, Nginx)

          Additional Information

          All your information will be kept confidential according to EEO guidelines.

          See more jobs at Bey

          Apply for this job

          +30d

          Full Stack PHP Developer with Laravel

          BeyPark St, Jersey City, NJ 07304, USA, Remote
          tailwindlaravelvuesassiosgitandroiddockermysqlcsslinuxangularAWSjavascriptfrontendPHP

          Bey is hiring a Remote Full Stack PHP Developer with Laravel

          Job Description

          Title: Full Stack PHP Developer

          Type: Fulltime

          Location: Remote

          Salary Range: DOE

          The Role:Client is looking to add a remote developer to its team to help us increase our ability to deliver more projects quickly while retaining the ability to maintain the website and improve site performance.

          Minimum 4 years’ experience with: PHP 7.x, Developing applications with Laravel, Working with a frontend JavaScript framework, Working knowledge of Git / GitHub, MySQL,

          Preferred experience in:Vue JS, Angular, Elastic Search & Algolia, Sass, Webpack / Gulp

          Bonus points:Tailwind CSS, Test-driven development, GitHub Actions, React Native, iOS / Android app development experience, Contributions to Open Source, Docker, Basic DevOps knowledge (AWS, Linux, Nginx)

          Additional Information

          All your information will be kept confidential according to EEO guidelines.

          See more jobs at Bey

          Apply for this job

          +30d

          (Senior) Full Stack Engineer (m/f/x)

          Exporo AGLissabon or remote, Portugal, Remote
          agiletailwindDesignscrummysqlcsspythonAWSbackendfrontend

          Exporo AG is hiring a Remote (Senior) Full Stack Engineer (m/f/x)

          A DAY AT EXPORO

          As part of our Tech & Product organization, you’ll help us to build modern, beautiful, and stable web applications - either in Germany or Portugal.

          You’ll work collaboratively with product managers and designers to drive the implementation and release of major features. You’ll be a champion of engineering best practices for writing stable, well-tested, and well-organized code.

          You will be a part of the leading platform for digital real estate investments in Germany. Your team is organized independently and in small agile teams which in some cases are spread throughout Europe.

          We believe that user-centric design ultimately leads to the best products, so we listen closely to our users, both external and internal. As an engineer of our agile teams, you’ll be an active voice in shaping our product. Exporo is constantly rolling out high-demand features and tackling ever greater challenges of scale.

          THE TECH STACK

          At Exporo one of our basic philosophies is ‘cloud only’. Therefore we make extensive use of Amazon Web Services (AWS), to build all our platform apps and services. Along our tech journey, we created various apps using AWS EC2, ECS/Fargate/Docker, and AWS Lambda with the Serverless framework. Most likely you’ll find a bit of everything in your tech infrastructure.

          When it comes to code, we use PHP/Laravel, NodeJS/Typescript as well as Python for backend development. On the frontend side we utilize current frameworks like React, Vue.js, Tailwind CSS and others to create modern and beautiful user interfaces, templated with the material.io design system.

          Infrastructure as code with AWS CDK or Serverless Framework is a standard in order to automate our internal processes.

          Many different tools for monitoring are integrated into our system landscape to see what’s going on under the hood, like several ELK stacks, Epsagon, Sentry and Looker.

          Since we have a remote work model in place, you will be welcome in our offices in either Hamburg or Lisbon 2-3 days a quarter.

          WHAT WE ARE LOOKING FOR

          • 5+ years of experience as a Software Engineer in a product-driven tech company with a track record of delivering software with high business impact
          • In-depth knowledge and experience with PHP/ TypeScript/ NodeJS as well as databases No-SQL/ MySQL is required
          • You cherish clean code, maintainable software architecture and enjoy improving on these skills even further
          • Experience with Scrum or other agile development methodologies
          • Someone who can take responsibility and likes a challenge
          • You should be interested in the analysis and the understanding of the business processes and you should use your analytic skills and structured approach while solving problems
          • An agile mindset, curiosity, and motivation to create and actively co-design products are some of your main characteristics.


          WHAT WE OFFER

          • A growing team of diverse experts that is passionate about reaching our goals
          • The chance to use your skills and experience to directly contribute to the company’s success and leave your footprint
          • A positive working atmosphere where everyone is encouraged to bring in new ideas for constant improvement
          • Competitive Salary
          • Language courses with the App Busuu
          • An annual training budget
          • Fully remote in Germany or Portugal with quarterly team days in Hamburg or Lisbon
          • Free HIIT workouts at Urban Heroes
          • Yoga classes on our spacious roof terrace
          • Subsidisation of a job ticket (public transportation)
          • Modern offices with great rooftop terraces in central locations
          +30d

          (Senior) Software Engineer - Frontend (m/f/x)

          Exporo AGHamburg or remote, Deutschland, Remote
          agiletailwindDesignscrumcsspythonAWSreactjsbackendfrontend

          Exporo AG is hiring a Remote (Senior) Software Engineer - Frontend (m/f/x)

          A DAY AT EXPORO

          As part of our Tech & Product organization, you’ll help us to build modern, beautiful, and stable web applications - either in Germany or Portugal.

          You’ll work collaboratively with product managers and designers to drive the implementation and release of major features. You’ll be a champion of engineering best practices for writing stable, well-tested, and well-organized code.

          You will be a part of the leading platform for digital real estate investments in Germany. Your team is organized independently and in small agile teams which in some cases are spread throughout Europe.

          We believe that user-centric design ultimately leads to the best products, so we listen closely to our users, both external and internal. As an engineer of our agile teams, you’ll be an active voice in shaping our product. Exporo is constantly rolling out high-demand features and tackling ever greater challenges of scale.

          THE TECH STACK

          At Exporo one of our basic philosophies is ‘cloud only’. Therefore we make extensive use of Amazon Web Services (AWS), to build all our platform apps and services. Along our tech journey, we created various apps using AWS EC2, ECS/Fargate/Docker, and AWS Lambda with the Serverless framework. Most likely you’ll find a bit of everything in your tech infrastructure.

          When it comes to code, we use PHP/Laravel, NodeJS/Typescript as well as Python for backend development. On the frontend side we utilize current frameworks like React, Vue.js, Tailwind CSS and others to create modern and beautiful user interfaces, templated with the material.io design system.

          Infrastructure as code with AWS CDK or Serverless Frameworks is a standard us in order to automate our internal processes.

          Many different tools for monitoring are integrated into our system landscape to see what’s going on under the hood, like several ELK stacks, Epsagon, Sentry and Looker.

          Since we have a remote work model in place, you will be welcome in our offices in either Hamburg or Lisbon 2-3 days a quarter.


          WHAT WE ARE LOOKING FOR

          • 3+ years of experience as a Software Engineer with a focus on frontend development in a product-driven tech company with a track record of delivering software with high business impact

          • Experience with various Content Management Systems (CMS) like Contentful, Forestry and alike

          • In-depth knowledge and experience with Vuejs, Reactjs or Angularjs is required

          • You cherish clean code, maintainable software architecture and enjoy improving on these skills even further

          • Experience with Scrum or other agile development methodologies

          • Someone who can take responsibility and likes a challenge

          • You should be interested in the analysis and the understanding of the business processes and you should use your analytic skills and structured approach while solving problems

          • An agile mindset, curiosity, and motivation to create and actively co-design products are some of your main characteristics.


          WHAT WE OFFER

          • A growing team of diverse experts that is passionate about reaching our goals
          • The chance to use your skills and experience to directly contribute to the company’s success and leave your footprint
          • A positive working atmosphere where everyone is encouraged to bring in new ideas for constant improvement
          • Competitive Salary
          • Language courses with the App Busuu
          • An annual training budget
          • Fully remote in Germany or Portugal with quarterly team days in Hamburg or Lisbon
          • Free HIIT workouts at Urban Heroes
          • Yoga classes on our spacious roof terrace
          • Subsidisation of a job ticket (public transportation)
          • Modern offices with great rooftop teraces in central locations
          +30d

          (Senior) Software Engineer - Backend (m/f/x)

          Exporo AGHamburg or remote, Deutschland, Remote
          agiletailwindlaravelDesignscrummysqlcsspythonAWSbackendfrontendPHP

          Exporo AG is hiring a Remote (Senior) Software Engineer - Backend (m/f/x)

          A DAY AT EXPORO

          As part of our Tech & Product organization, you’ll help us to build modern, beautiful, and stable web applications - either in Germany or Portugal.

          You’ll work collaboratively with product managers and designers to drive the implementation and release of major features. You’ll be a champion of engineering best practices for writing stable, well-tested, and well-organized code.

          You will be a part of the leading platform for digital real estate investments in Germany. Your team is organized independently and in small agile teams which in some cases are spread throughout Europe.

          We believe that user-centric design ultimately leads to the best products, so we listen closely to our users, both external and internal. As an engineer of our agile teams, you’ll be an active voice in shaping our product. Exporo is constantly rolling out high-demand features and tackling ever greater challenges of scale.

          THE TECH STACK

          At Exporo one of our basic philosophies is ‘cloud only’. Therefore we make extensive use of Amazon Web Services (AWS), to build all our platform apps and services. Along our tech journey, we created various apps using AWS EC2, ECS/Fargate/Docker, and AWS Lambda with the Serverless framework. Most likely you’ll find a bit of everything in your tech infrastructure.

          When it comes to code, we use PHP/Laravel, NodeJS/Typescript as well as Python for backend development. On the frontend side we utilize current frameworks like React, Vue.js, Tailwind CSS and others to create modern and beautiful user interfaces, templated with the material.io design system.

          Infrastructure as code with AWS CDK or Serverless Framkework is a standard us in order to automate our internal processes.

          Many different tools for monitoring are integrated into our system landscape to see what’s going on under the hood, like several ELK stacks, Epsagon, Sentry and Looker. 

          Since we have a remote work model in place, you will be welcome in our offices in either Hamburg or Lisbon 2-3 days a quarter.

          WHAT WE ARE LOOKING FOR

          • 3+ years of experience as a Software Engineer with backend focus in a product-driven tech company with a track record of delivering software with high business impact
          • In-depth knowledge and experience with PHP/ TypeScript/ NodeJS as well as databases No-SQL/ MySQL is required
          • AWS Lambda, PHP (Symfony/ Laravel) or Python are a plus
          • You cherish clean code, maintainable software architecture and enjoy improving on these skills even further
          • Experience with Scrum or other agile development methodologies
          • Someone who can take responsibility and likes a challenge
          • You should be interested in the analysis and the understanding of the business processes and you should use your analytic skills and structured approach while solving problems
          • An agile mindset, curiosity, and motivation to create and actively co-design products are some of your main characteristics.


          WHAT WE OFFER

          • A growing team of diverse experts that is passionate about reaching our goals
          • The chance to use your skills and experience to directly contribute to the company’s success and leave your footprint
          • A positive working atmosphere where everyone is encouraged to bring in new ideas for constant improvement
          • Competitive Salary
          • Language courses with the App Busuu
          • An annual training budget
          • Fully remote in Germany or Portugal with quarterly team days in Hamburg or Lisbon
          • Free HIIT workouts at Urban Heroes
          • Yoga classes on our spacious roof terrace
          • Subsidisation of a job ticket (public transportation)
          • Modern offices with great rooftop teraces in central locations
          +30d

          Frontend Software Engineer (Manufacturing Apps)

          Accesa IT Systems SRLEmployees can work remotely, Romania, Remote
          agiletailwindDesignmobileazuresassscrumiosqa.netandroidtypescriptcssangularjavascriptbackendfrontend

          Accesa IT Systems SRL is hiring a Remote Frontend Software Engineer (Manufacturing Apps)

          Company Description

          Part of the Ratiodata Group, Accesa is a leading technology company headquartered in Cluj-Napoca, with offices in Oradea and Munich. Over the past 17 years, the company has been establishing itself as an employer of choice for IT professionals who are passionate about problem-solving through technology and want to have a measurable impact through their work.

          A trusted partner for major brands in Retail, Consumer Goods, Manufacturing, and Automotive, Accesa helps businesses embrace flexibility, adaptability, and evolution within their digital journey, through a large spectrum of tailored IT services, leveraging mainstream, niche, as well as legacy technologies.

          Its sister-company RaRo delivers complex digital evolution solutions for highly regulated industries like Insurance and Banking and, together, the two companies cover the complete digital evolution journey of their customers, from hardware to software and managed services solutions.

          With more than 700 IT professionals in its 13+ Competence Areas, the two sister-companies join forces to build a distinctive people-first culture that enables their people to thrive, their clients’ business to evolve and end users to succeed.

          Job Description

          About the project

          Together with our customer, a world-leading provider of integrated solutions for production in the woodworking industry, we are building cross-platform apps - web, Android, iOS - that support the machine operators and technicians to fulfill their job more easily and more effectively, but also to have a better overview of the manufacturing state and process. The frontend development is covered completely by us - we outlined the architecture right from the beginning, which will ensure our future colleague a great means to develop his/her skills on the job and have a real impact on a cutting-edge enterprise project. The software development project follows a scrum methodology and is based on strong, transparent, and effective collaboration with our client. 

          Your team

          The team consists of 20+ colleagues and offers to our client a large variety of roles and skills: frontend and backend development (from junior to lead), QA, scrum mastering, business analysis, product management, and project management. The team has started working together about 3 years ago and has grown steadily and in a healthy way.

          Your role

          • Research, design, write and test new web applications using Agile software methodologies
          • Contribute to the improvement of our Frontend community, focusing on continuous integration and continuous delivery
          • Update periodically your technical knowledge and skills by attending in-house courses
          • Interact with all stakeholders bringing the delivered product to the next level
          • Apply problem-solving and lateral thinking skills while collaborating, or individually, to meet the project needs

          Real impact one step at a time 

          You will have an impact on the project’s evolution, as well as the chance to contribute with your own ideas and expertise in building a successful relation with the client.

          Professional opportunities

          In this role, you will interact with different stakeholders to understand the business context and support them in the digitalization process. You will participate in all aspects of the software development lifecycle and have the opportunity to contribute with solutions to improve our customer’s technological ecosystem.

          Community insights

          Our competence center supports professional development according to the individual needs and the project's context.

          Qualifications

          • 3+ years of experience in Web Applications using JavaScript or some of its most common libraries/frameworks (Angular, Typescript, etc.).
          • Good knowledge of HTML, CSS, JSON, and CSS preprocessors: SASS, LESS, etc.
          • Tailwind CSS experience is a plus.
          • Familiar with testing frameworks and focused on delivering qualitative artifacts
          • Interest in XP practices (pair programming, TDD, simple design, etc.)
          • Experience in solving problems, being able to analyze tasks of different complexity
          • Positive and collaborative attitude
          • Team player, having the curiosity and passion for continuous improvement
          • Fluent in English (written and spoken)

          Experience with .NET platforms (.NET Framework, .NET Core) & with Azure Cloud Services: Cosmos DB, Blob Storage, Service Bus are a plus, given the opportunity the project provides to be involved as a full stack developer.

          Additional Information

          At Accesa & RARo you can:

          Enjoy our holistic benefits program that covers the four pillars that we believe come together to support our wellbeing, covering social, physical, emotional wellbeing, as well as work-life fusion.

          • Physical: premium medical package for both our colleagues and their children, dental coverage up to a yearly amount, eyeglasses reimbursement every two years, voucher for sport equipment expenses, in-house personal trainer
          • Emotional: individual therapy sessions with a certified psychotherapist, webinars on self-development topics
          • Social: virtual activities, sports challenges, special occasions get-togethers
          • Work-life fusion: yearly increase in days off, flexible working schedule, birthday, holiday and loyalty gifts for major milestones

          See more jobs at Accesa IT Systems SRL

          Apply for this job

          +30d

          Full Stack Developer

          Security TrailsRemote, Florida, United States
          jirascalatailwindlaravelDesignslackapigitelasticsearchcsspythonAWSjavascriptbackend

          Security Trails is hiring a Remote Full Stack Developer

          We are looking for an experienced Laravel/PHP full-stack engineer who will help us secure the Internet by developing robust APIs, data platforms and full-stack web platforms which power the best internet inventory platform available.  Your primary focus will be the development of a mixture of backend API services, web applications and integrations with existing internal and external services.  You’ll bring your experience and knowledge to a rapidly growing team of professionals around the world and have the opportunity to shape our technology and culture.


          Your responsibilities

          • Architect and implement new features from specification to production delivery
          • Support our Services Oriented Architecture design by integrating with various data services internally and externally
          • Support multiple codebases and enforce best practices, including reliable test coverage
          • Communicate with stakeholders and peers in English across multiple communication channels such as Slack and Zoom
          • Work during our Eastern Time Zone business hours of 9:00am to 5:00pm


          You are skilled in

          • Expert knowledge in Laravel 8.0+
          • Experience utilizing Laravel Vapor for serverless based deployments
          • Understanding of CI/CD methodologies (We use CircleCI)
          • Experience writing unit and integration tests
          • Expert knowledge in using Laravel Eloquent for complex database queries
          • Expert knowledge in HTML/CSS and Javascript
          • Experience utilizing CSS frameworks such as bootstrap and Tailwind (We use Tailwind)
          • Experience utilizing interactive JS frameworks such as React, Vue.js and Livewire (We use Livewire and React)
          • Understanding of web optimization techniques such as using Content Delivery Networks, optimized JS bundling, CSS optimization and more)
          • Experience building and consuming REST based APIs
          • Experience utilizing git based code repositories and knowledge of the git-flow workflow
          • Experience using project management tools (We use Atlassian Jira)


          Nice to have

          • Knowledge of Elasticsearch or other Big Data technologies
          • passion for new technologies and software development best practices
          • other language experience such as Python, GoLang, Scala or Elixir
          • Experience working in Cloud based environments and using managed services (We use AWS)


          Your benefits

          • great company culture
          • working full-time remotely
          • paid trips to team meetups
          • teammates from countries all over the world
          • paid vacations
          • educational support


          Visit us to learn more about ourremote work cultureand ourfurther open jobs!


          Our mission

          SecurityTrails strives to make the biggest treasure-trove of cyber intelligence data readily available in an instant. We work relentlessly to empower experts so they can thwart future attacks with up-to-date data, proprietary tools, and custom solutions.


          A Security Beast Built Bit By Bit

          We started because we were tired. Tired of combing through domain lists and forensic data manually, tired of searching through numerous sites for all the data we needed. We patiently waited for the perfect tool, but it never came. Our solution had to be vast, fast, and able to update daily — so we assembled a talented team and built it from scratch.

          SecurityTrails was founded in June 2017, and from the very start it was decided that it would be a fully remote team. What began as a team of three people based in the US has grown into a team that currently counts 30 individuals. And that’s not even taking into account the number of contractors we work with, living and working across the entire globe.


          See more jobs at Security Trails

          Apply for this job

          +30d

          Web Developer

          MirantisCampbell, CA, USA, Remote
          tailwindvueqagitcsskubernetesjavascript

          Mirantis is hiring a Remote Web Developer

          Company Description

          Mirantis is the fastest way to modern apps, providing containers-as-a-service at enterprise scale. The company uses a unique as-a-service model to deliver Kubernetes and related open source software, empowering developers to build, share and run their applications anywhere - from public cloud to hybrid cloud to the edge. Mirantis serves many of the world’s leading enterprises, including Adobe, DocuSign, Liberty Mutual, PayPal, Reliance Jio, Splunk, STC, Vodafone, and Volkswagen. Learn more at www.mirantis.com.

          Job Description

          Mirantis is adding a Web Developer to our team! Mirantis’ Marketing department is looking for an experienced web developer who will be responsible for developing, testing, publishing and maintaining web pages and websites, including layout to functionality, according to stakeholder specifications and organizational standards.

          Main Responsibilities:

          • Develop new components and features for Mirantis web properties using clean code principles

          • Manage and deploy content including copy and creative assets on the company’s various websites

          • Optimize website experiences and user journeys

          • Use strong organization skills to balance priorities, keeping a keen eye on consistently driving value for the business  

          • Manage inter-departmental requests and website QA processes

          • Deliver on assigned tickets, working closely with stakeholders to ensure smooth execution 

          • Work with the Web Optimization team to improve site performance, growing your SEO expertise

          Qualifications

          • Strong understanding of Vue.js and its core principles

          • Familiarity with headless CMS platforms such as Storyblok, Butter or Prismic

          • Familiarity with the Vue.js ecosystem, including Vue CLI, Vuex, Vue Router, and Nuxt.js

          • Understanding of server-side rendering and its benefits and use cases

          • Ability to write efficient, secure, well-documented, and clean JavaScript code

          • Familiarity with modern development tools, like Babel, Webpack, and Git

          • Strong understanding of HTML, CSS, SCSS/SASS, Tailwind CSS, Bootstrap 4

          Additional Information

          What does Mirantis offer you?

          • Work with an established leader in the cloud infrastructure industry.
          • Work with exceptionally passionate, talented and engaging colleagues, helping Fortune 500 and Global 2000 customers implement next-generation cloud technologies.
          • Be a part of cutting-edge, open-source innovation.
          • Thrive in the high-energy environment of a young company where openness, collaboration, risk-taking, and continuous growth are valued.
          • Receive a competitive compensation package with strong benefits plan and stock options.

          Mirantis ranked in the top 50 of G2's Best IT Cloud Products of 2021!

          See more jobs at Mirantis

          Apply for this job