symfony Remote Jobs

102 Results

5d

Mid Symfony Developer

StrixRemote job, Remote
B2BmagentoRabbitMQDesigngraphqlapisymfonygitc++dockerPHP

Strix is hiring a Remote Mid Symfony Developer

Poszukujemy programistów, których pasją jest budowanie i rozwijanie światowej klasy systemów e-commerce. Jako członek naszego zespołu staniesz przed wieloma ciekawymi wyzwaniami, takimi jak: tworzenie wymagających integracji dużych baz danych czy innowacyjnych funkcjonalności dla naszych klientów. Nie będziesz tylko kodował - będziesz uczestniczył w każdym etapie procesu rozwoju projektu wraz z grupą utalentowanych profesjonalistów.

O projekcie

Jako oficjalny partner Shopware, wdrażamy rozwiązania e-commerce w oparciu o Shopware (jeden z najbardziej innowacyjnych systemów sklepowych na rynku).

Stack technologiczny

  • PHP 7.4/8.1

  • MySql/MariaDB/PostgreSQL

  • RabbitMQ

  • Docker

Framework

  • Symfony 5.3+

Metodologie

  • Unit testing (PHPUnit)

  • Functional API testing (Behat)

  • Domain Driven Design Layered Architecture

  • Open Source

  • Gitflow


Wynagrodzenie: 10 000 - 13 300 PLN brutto (UoP), 12 000 - 16 000 PLN netto + VAT (B2B)

See more jobs at Strix

Apply for this job

18d

PHP Developer

RTB HouseRemote, Warsaw, Poland
sqllaravelvuesymfonylinuxangularPHP

RTB House is hiring a Remote PHP Developer

Description

Obowiązki:

  • tworzenie narzędzi mających na celu automatyzację i optymalizację procesów finansowych i sprzedażowych w firmie;
  • obsługa i rozwój istniejących rozwiązań wspomagających codzienną pracę zespołów finansowych i sprzedażowych;
  • testowanie kodu;
  • czuwanie nad jakością tworzonego kodu.

Oczekiwania:

  • bardzo dobra znajomość PHP7;
  • bardzo dobra znajomość SQL;
  • przynajmniej podstawowa umiejętność obsługi Linux;
  • doświadczenie w programowaniu aplikacji webowych;
  • wysoka motywacja do pracy oraz orientacja na realizację wyznaczonych celów;
  • umiejętności analityczne i organizacyjne;
  • bardzo dobra znajomość języka polskiego oraz znajomość języka angielskiego umożliwiająca swobodne czytanie i pisanie.

Mile widziane:

  • znajomość frameworka Laravel i/lub Symfony;
  • znajomość Dockera;
  • doświadczenie z nowoczesnymi frameworkami frontendowymi (React, Vue, Angular);
  • zainteresowanie tematyką finansową.

 Oferujemy

  • udział w jednym z najciekawszych projektów branży online zarówno w Polsce, jak i w skali globalnej;
  • pracę w jednej z najszybciej rozwijających się firm technologicznych w Europie;
  • atrakcyjne wynagrodzenie;
  • pracę przy różnorodnych projektach i ciągłym rozwoju oprogramowania;
  • nieformalną oraz przyjazną atmosferę i bycie częścią zespołu osób o ciekawych doświadczeniach i zainteresowaniach;
  • współfinansowanie kursu języka obcego oraz szkoleń;
  • ciągły rozwój zawodowy oraz możliwość podnoszenia kwalifikacji.

See more jobs at RTB House

Apply for this job

+30d

Senior Back-End Engineer (API)

ProtonMailRemote (Europe), Warsaw, Barcelona, London, Paris, Prague;, Czechia, Remote
agile3 years of experiencesqlDesignmetalapisymfonydockerkuberneteslinuxPHP

ProtonMail is hiring a Remote Senior Back-End Engineer (API)

A better internet is possible, one that empowers people to choose how their personal information is used. This might seem daunting, or even impossible, but at Proton, building this better internet is what we do every day.


Proton was founded in 2014 by a group of scientists who met at the European Organization for Nuclear Research (CERN). Our first product, ProtonMail, is now the world’s largest encrypted email service. Subsequent Proton products, such as ProtonVPN, Proton Calendar, and Proton Drive, use end-to-end encryption that gives our users full control over how and with whom their data is shared.


Today, Proton is making privacy universally accessible to more than 50 million registered users, including journalists, some of the world’s largest organizations, and people in more than 180 countries. Our diverse and dynamic team is made up of more than 400 members representing over 30 different nationalities. While we are based in Geneva, Switzerland, we have offices in Zurich, Prague, London, Vilnius, Skopje, Taipei, and many more employees working remotely around the world.


New York Times journalists, some of the world’s largest corporations, and millions of ordinary citizens use our products so they can choose who, if anyone, sees their information. Join us at one of Europe’s fastest-growing companies to help us solve challenging problems and build new products that will reach hundreds of millions of people. We want to create more than just one of the world’s most impactful tech companies, we want to create a new internet that serves the interests of all people. We need you, your voice, your ideas, and your ambition to make it happen.


Purpose of the role

Our Payments and Core teams are looking for Back-End Engineers to help build efficient, testable, and well-documented code that delivers real business value.

Both Core and Payments teams focus on creating technical implementations that are shared across all Proton products: ProtonMail, ProtonCalendar, ProtonDrive, and ProtonVPN. The reliability of our core codebase is crucial for the consistent and smooth functioning of all our products.

We aim to deliver the best experience for people who care about their security and privacy.

Enjoy the benefits of a flexible work environment that values independent contributors, as well as working in teams using Agile workflows.


What you will do

  • Design, build, and maintain large-scale products
  • Ensure that all parts of the technical design are correctly incorporated
  • Write high quality, tested, and documented code
  • Follow and improve high engineering standards and best practices

See more jobs at ProtonMail

Apply for this job

+30d

Engineering Director - Drive

ProtonMailLondon, Geneva, Zürich, Prague, Switzerland, Remote
kotlinsqlDesignswiftmobilemetaliossymfonyandroidtypescriptpythonPHP

ProtonMail is hiring a Remote Engineering Director - Drive

A better internet is possible, one that empowers people to choose how their personal information is used. This might seem daunting, or even impossible, but at Proton, building this better internet is what we do every day.

ProtonMail was founded in 2014 by a group of scientists who met at the European Organization for Nuclear Research (CERN). Our first product, ProtonMail, is now the world’s largest encrypted email service. Subsequent Proton products, such as ProtonVPN, Proton Calendar, and Proton Drive, use end-to-end encryption that gives our users full control over how and with whom their data is shared.

Today, Proton is making privacy universally accessible to more than 50 million registered users, including journalists, some of the world’s largest organizations, and people in more than 180 countries. Our diverse and dynamic team is made up of more than 400 members representing over 30 different nationalities. While we are based in Geneva, Switzerland, we have offices in Zurich, Prague, London, Vilnius, Skopje, Taipei, and many more employees working remotely around the world.

New York Times journalists, some of the world’s largest corporations, and millions of ordinary citizens use our products so they can choose who, if anyone, sees their information. Join us at one of Europe’s fastest-growing companies to help us solve challenging problems and build new products that will reach hundreds of millions of people. We want to create more than just one of the world’s most impactful tech companies, we want to create a new internet that serves the interests of all people. We need you, your voice, your ideas, and your ambition to make it happen.


Purpose of the role

As Engineering Director for Proton Drive, you will lead four teams building end-to-end encrypted online storage products serving millions of Proton customers worldwide. You will be responsible for defining your organizational structure, ensuring best practices in code quality and architectural design, and maintaining alignment across mobile, web, and desktop clients. You will lead design and development of systems and customer experiences at scale, and partner with product managers to develop strategic direction for your teams. As a member of the Proton engineering leadership team, you will advocate for making continuous investments in developer productivity and code quality, while ensuring fast feature delivery for your customers. You will report directly to the VP of Engineering.


What you will do

  • Serve as head of engineering for Proton Drive
  • Lead through others, and develop the next generation of engineering leaders at Proton
  • Inspire, coach, and develop your teams
  • Optimize your organizational structure, and continuously raise the bar on hiring
  • Build relationships with senior leaders, and advance your long-term platform and engineering vision
  • Lead technical design and platform discussions
  • Drive continuous improvement in our DevOps practices, and improve lead times and time to market while maintaining exceptional standards of product quality
  • Hold yourself and your teams accountable to high engineering standards
  • Develop efficient processes, and motivate your team to operate with high velocity, ownership, and accountability
  • Contribute to Proton's technology and open source communities
  • Foster an inclusive and diverse environment for your team to show up and give their best each day


Technologies we use

  • Applied cryptography (PGP, TLS, etc.)
  • REST APIs
  • Event architectures
  • HTTP networking
  • SQL, Redis
  • PHP (Symfony), Golang, Python
  • iOS, macOS (Swift)
  • Android (Kotlin, Jetpack)
  • Web (Typescript, React)

    See more jobs at ProtonMail

    Apply for this job

    +30d

    PHP Backend Developer

    4 years of experiencelaravelscrumapisymfonygitAWSbackendPHP

    ActiveProspect, Inc. is hiring a Remote PHP Backend Developer

    Company Overview

    LeadsBridge is a fast-growing automation solution that focuses on connecting top advertising platforms - Google, Facebook, LinkedIn, and TikTok - with main marketing tools - CRM, email marketing software, autoresponder, and so much more. With ready-made and custom-made integrations, LeadsBridge builds automated workflows that allow sending lead data from a source into a destination of choice in real-time, while always maintaining CCPA and GDPR compliance.

    With thousands of customers spanning the globe across industries, LeadsBridge was recently added to ActiveProspect’s product portfolio, representing a step forward to making consent-based marketing the BEST channel for customer acquisition & lead generation across the world.

     

    #TogetherIsBetter is one of our mottos.

    This is a short video during our last mega camp, let’s get loud!

    2021https://www.linkedin.com/feed/update/urn:li:activity:6841397149717164033

    Job Summary

    As a Senior Backend Engineer on the LeadsBridge team, you will play a vital role in maintaining and adding features to the LeadsBridge product. You will join our team of back-end developers bringing value to our product according to SCRUM methodology, through 2w iterations, working on a prioritized backlog and on user stories defined by the Product team and Product Owner.

    As such, you will:

    • Ship clean, well-tested code to production on a regular basis
    • Work closely with the LeadsBridge engineers and the Product Owner to develop new cool features
    • Participate in planning and estimating to continuously improve the product
    • Perform code reviews and share code with other engineers
    • Provide input and technical direction for backend development
    • Contribute to the migration of our PHP legacy application to the new Laravel app (ETA 1 year)
    • Wrote and update technical documentation
    • Participate in bootcamps in Italy and around the world where you can finally meet "in person" your colleagues, exchange ideas and thoughts, do team-building activities and together contribute to creating a better LeadsBridge.

    As such, you will:

    • Ship clean, well-tested code to production on a regular basis
    • Work closely with the LeadsBridge engineers and the Product Owner to develop new cool features
    • Participate in planning and estimating to continuously improve the product
    • Perform code reviews and share code with other engineers
    • Provide input and technical direction for backend development
    • Contribute to the migration of our PHP legacy application to the new Laravel app (ETA 1 year)
    • Wrote and update technical documentation
    • Participate in bootcamps in Italy and around the world where you can finally meet "in person" your colleagues, exchange ideas and thoughts, do team-building activities, and together contribute to creating a better LeadsBridge.

     

    Qualifications and Skills

    • More than 4 years of experience working as a backend developer
    • Strong knowledge of Laravel framework
    • Strong knowledge of Vanilla PHP and Object-Oriented Programming
    • Familiarity with REST/SOAP API
    • Proficient with Git
    • Fluent Italian
    • Highly proficient in spoken and written English
    • Driven to continue learning and exploring
    • Open-minded and passionate about solving problems

    How to Stand Out 

    • Familiarity with PHPUnit or Pest
    • Familiarity with other PHP popular frameworks (Symfony, Yii, etc.)
    • Experience with AWS (S3, Dynamo, SQS, etc.)
    • Within 2 hours of Central European Time

    Benefits and Perks

    • Work remotely → live and work wherever you like. Remote: 
    • Vacation → at least 4 weeks/year
    • Career Path→ if you are looking for a transparent, growing career, LeadsBridge is the right choice!
    • Retreats → meet your colleagues twice per year! Our next retreat camp will be in Sep/2022 in…
    • Monthly benefit → $150/mo that you can spend for working appliances, gym, training (or any wellness activities), buy books/courses and cover connectivity costs.

    LeadsBridge (now an ActiveProspect business)  is an Equal Opportunity Employer.

    As a part of being an equal opportunity employer, we are passionate about working with talented and empathetic people. As such, we want you to bring your authentic self to work every single day. We accept you for who you are and consider everyone on an equal opportunity basis.

     

    See more jobs at ActiveProspect, Inc.

    Apply for this job

    +30d

    Senior Backend Engineer

    4 years of experiencelaravelscrumapisymfonygitAWSbackendPHP

    ActiveProspect, Inc. is hiring a Remote Senior Backend Engineer

    Company Overview

    LeadsBridge is a fast-growing automation solution that focuses on connecting top advertising platforms - Google, Facebook, LinkedIn, and TikTok - with main marketing tools - CRM, email marketing software, autoresponder, and so much more. With ready-made and custom-made integrations, LeadsBridge builds automated workflows that allow sending lead data from a source into a destination of choice in real-time, while always maintaining CCPA and GDPR compliance.

    With thousands of customers spanning the globe across industries, LeadsBridge was recently added to ActiveProspect’s product portfolio, representing a step forward to making consent-based marketing the BEST channel for customer acquisition & lead generation across the world.

     

    #TogetherIsBetter is one of our mottos.

    This is a short video during our last mega camp, let’s get loud!

    2021https://www.linkedin.com/feed/update/urn:li:activity:6841397149717164033

    Job Summary

    As a Senior Backend Engineer on the LeadsBridge team, you will play a vital role in maintaining and adding features to the LeadsBridge product. You will join our team of back-end developers bringing value to our product according to SCRUM methodology, through 2w iterations, working on a prioritized backlog and on user stories defined by the Product team and Product Owner.

    As such, you will:

    • Ship clean, well-tested code to production on a regular basis
    • Work closely with the LeadsBridge engineers and the Product Owner to develop new cool features
    • Participate in planning and estimating to continuously improve the product
    • Perform code reviews and share code with other engineers
    • Provide input and technical direction for backend development
    • Contribute to the migration of our PHP legacy application to the new Laravel app (ETA 1 year)
    • Wrote and update technical documentation
    • Participate in bootcamps in Italy and around the world where you can finally meet "in person" your colleagues, exchange ideas and thoughts, do team-building activities and together contribute to creating a better LeadsBridge.

    Qualifications and Skills

    • More than 4 years of experience working as a backend developer
    • Strong knowledge of Laravel framework
    • Strong knowledge of Vanilla PHP and Object-Oriented Programming
    • Familiarity with REST/SOAP API
    • Proficient with Git
    • Fluent Italian
    • Highly proficient in spoken and written English
    • Driven to continue learning and exploring
    • Open-minded and passionate about solving problems

    How to Stand Out 

    • Familiarity with PHPUnit or Pest
    • Familiarity with other PHP popular frameworks (Symfony, Yii, etc.)
    • Experience with AWS (S3, Dynamo, SQS, etc.)
    • Within 2 hours of Central European Time

    Benefits and Perks

    • Work remotely → live and work wherever you like. Remote: 
    • Vacation → at least 4 weeks/year
    • Career Path→ if you are looking for a transparent, growing career, LeadsBridge is the right choice!
    • Retreats → meet your colleagues twice per year! Our next retreat camp will be in Sep/2022 in…
    • Monthly benefit → $150/mo that you can spend for working appliances, gym, training (or any wellness activities), buy books/courses and cover connectivity costs.

    LeadsBridge (now an ActiveProspect business)  is an Equal Opportunity Employer.

    As a part of being an equal opportunity employer, we are passionate about working with talented and empathetic people. As such, we want you to bring your authentic self to work every single day. We accept you for who you are and consider everyone on an equal opportunity basis.

     

    See more jobs at ActiveProspect, Inc.

    Apply for this job

    +30d

    Software Engineer, Product Platform

    JazzHRRemote
    agilekotlinDesignsymfonyjavaPHP

    JazzHR is hiring a Remote Software Engineer, Product Platform

     

    JazzHR’s product platform team is a small group focused on building and maintaining software aimed at making the rest of our engineering organization more efficient.

    We tackle big technical challenges for systems at scale every day.

    Our team is built on mutual respect and trust. We emphatically embrace a culture of continued learning and growth, and are empowered to innovate, explore, and utilize our expertise to craft the right solutions for our customers.

    Our team values kindness and curiosity, driven by the desire to try, reflect, and adapt.

    We use modern software tooling and frameworks, such as Symfony (PHP), and Spring Boot (Java and Kotlin) running on Kubernetes. While experience with our present tech stack is a plus, we value foundational software engineering experience and a drive to delight our customers over any individual technical skill.

    What you'll do:​​

    • Architect and build robust, performant APIs.
    • Advocate for the health and quality of our systems.
    • Maintain and build common software components to be used across our product delivery teams.
    • Deliver highly maintainable and well-tested code.
    • Design scalable and generic data models that will hold up under high demand.
    • Mentor and guide software engineers on design techniques and coding standards.
    • Instrument software to provide key insights into production workloads.
    • Create reusable software templates to socialize best practices.

    You'll be a great fit if you have:

    • Great communication skills and a willingness to pair program, swarm on critical issues, and engage with your teammates to solve challenging problems.
    • Experience running and maintaining large-scale production systems.
    • Managed individual project priorities, deadlines, and deliverables using Agile methodologies.
    • Experience supporting the needs of fellow software engineers.
    • A drive to produce simple software, leaving systems you interact with easier to understand than when you found them.

    About JazzHR:

    JazzHR has raised the bar in the recruiting software industry, with many of our innovations becoming industry-standard. We’re the first company to put powerful, yet easy-to-use recruiting software in the hands of startups, growing companies, and small businesses from all industries. We're proud of our accomplishments - click here to see more!

    About Employ:

    Employ empowers organizations of all sizes to overcome their greatest recruiting and talent acquisition challenges. Offering a combination of purpose-built intelligent software technologies, services, and industry expertise, Employ provides businesses of all sizes with powerful solutions for recruiting a diverse workforce. Through its JazzHR and Jobvite technologies, and NXTThing RPO services, Employ serves more than 12,000 customers across all industries. For more information, visit www.employinc.com.

    JazzHR and Employ are equal opportunity employers. All employment decisions are solely based on business needs, job requirements and individual qualifications without regard to race, gender, religion, ethnicity, age or any other status protected by the laws and regulations where we operate.

    See more jobs at JazzHR

    Apply for this job

    +30d

    Programmer / Full Time / Remote Position / Marketing Technology SaaS

    MarketerRemote job, Remote
    4 years of experiencenosqllaravelDesignjqueryhtml5symfonymysqlcssangularjavascriptPHP

    Marketer is hiring a Remote Programmer / Full Time / Remote Position / Marketing Technology SaaS

    :: About Us

    Inc. Magazine has twice ranked our Company as one of the fastest-growing companies in the United States - and we aren’t done growing!

    That’s where you come in...

    We’re looking for new team members who are talented, driven, and passionate to join us in making a difference in today’s market.

    Our Company strives to deliver impact through (1) innovative, easy-to-use marketing automation software, (2) proven strategies to empower businesses to start up or scale up their dream, and (3) best-in-class support that scales with our customers. Even after 10 years of developing over 12 software platforms, building a private coaching program to train thousands of marketing leaders, and supporting tens of thousands of businesses … there is still so much we want to accomplish!

    So if you are looking to join other high achievers in an exciting, long-term opportunity with a global impact, then we have the perfect position for you! More importantly, if you want to expand your talents and experience the challenge of a high-growth environment, then I invite you to keep reading.

    :: About the role

    This is a rare chance to join a highly successful, high-growth enterprise that is building an empire. As a member of the engineering team, your key focus will be to build and maintain a robust feature set while integrating new technologies into our existing Enterprise level platforms.

    The right candidate will take ownership of the services, using their expertise to suggest improvements and help formulate the long-term product roadmap.

    This position offers a tremendous amount of growth, allowing you to expand as a contributing engineer on up to 12 applications in our suite of tools. All of which offer different opportunities and challenges to solve for the right individual.


    :: You Will -

    # Work with product managers, technical leads, and other engineers to design, develop, launch, and operate market-leading Marketing platforms

    # Use your experience to collaboratively help integrate our applications

    # Collaborate closely with both your senior leads and related engineers - promoting a shared understanding of how to solve common problems and provide solutions


    See more jobs at Marketer

    Apply for this job

    +30d

    Engineering Lead

    Firstbase.ioSão Paulo or Remote
    agile3 years of experiencefigmalaravelDesignvueslackapiqasymfonydockerpostgresqlAWSbackendfrontendPHP

    Firstbase.io is hiring a Remote Engineering Lead

    Engineering Lead at Firstbase.io (W21)
    All in one Company OS
    São Paulo or Remote / Remote
    Full-time
    3+ years
    About Firstbase.io

    Firstbase is building an all-in-one Company OS to help define how founders across the globe launch, manage and grow their businesses. More than ten thousand founders from over a hundred countries have used our product, Firstbase Start, to launch their startup. For many founders, "firstbase.io" has become what they type into their address bars when they think about incorporating a business.

    About the role

    Skills: Vue.js, PHP

    About the role

    Firstbase.io is hiring an Engineering Lead to work in tandem with the Product Managers, Engineers and Designers to shape the future of Firstbase’s products. You’ll thrive in this role if you have experience building relationships with and influencing cross-functional team members, delivering high quality projects on time, and analyzing data to produce actionable recommendations.

    Top candidates for this position will have a natural desire to continuously improve the product, enormous user empathy, and can maintain a calm demeanor in high stress situations. People describe our ideal Engineering Lead as accountable, organized, and customer obsessed.

    What's Firstbase.io

    Firstbase is building an all-in-one Company OS to help define how founders across the globe launch, manage, and grow their businesses.

    More than ten thousand founders from over a hundred countries have used our incorporation product, Firstbase Start, to launch their startup. For many founders, "firstbase.io" has become what they type into their address bars when they think about incorporating a business. 

    We are backed by Y Combinator & our team, investors, and advisors include people from Apple, Gusto, Carta, Wise, Plaid, and many other great companies.

    Why you should join

    Firstbase is much more than just incorporation. Our team is dedicated to building products & solving some of the startups’ hardest problems, with a particular focus in:

    • Democratizing access to financial infrastructure
    • Automating tasks every founder faces when running a business
    • Making tools and resources more accessible to everyone, everywhere
    • Building integrated solutions for founders and removing friction
    • Delivering opportunities to traditionally overlooked founders and companies
    • Democratizing access to knowledge

    Join us on a mission to help more companies succeed!

    Who are we looking for

    We are looking for risk-takers with diverse experience able to provide fearless feedback.

    You will have the following duties

    • Experience in growing and leading software engineering teams, managing developers and mentoring them
    • Experience leading end to end software development, from requirements, through architecture, development, testing, delivery and all associated processes
    • Experience working on complex software systems involving both Cloud/SaaS and On-Prem, in microservices architectures
    • Knowledge of agile development processes and best practices, and demonstrated experience assimilating those to achieve streamlined execution
    • Ability and desire to span from high-level concepts to low-level details of implementation
    • Versed in a wide variety of user facing and back-end technologies and architecture

    You should meet the following requirements

    • At least 3 years of experience leading software development teams
    • BSc in computer science, electrical engineering or equivalent
    • Startup experience, building production systems from an early stage
    • Experience working on products sold to enterprise customers
    • Familiarity with concepts of IT environments and complex integrations
    • Experience with PHP, Symfony, Vue and its ecosystem
    • Hands-on experience with modern Frontend and Backend technologies
    • Experience working on products involving machine and deep learning
    • Experience dealing with time series data
    • Understanding control systems

    Some perks you might enjoy

    • Competitive salary and equity: We lean on some of the best market data to ensure that we offer the most competitive compensation.

    • Hybrid work environment: We work both remotely & from our offices in New York City in São Paulo – optimizing for collaboration while providing flexibility to team members.

    • 21 days of PTO + birthday off: We offer flexibility to allow people to relax and recharge whenever they need it.

    • Build your ideal work setup: We understand that how you work is extremely important, so we provide a stipend to set yourself up for success here at Firstbase.

    • Health benefits: Firstbase offers health insurance reimbursements to both US and international employees.

    • Learning and development: We provide a stipend together with resources to help people grow and develop in their careers.

    • Amazing quarterly bonus: Every team at Firstbase has a bonus structure that usually accounts for 20-25% of OTE.

    The stack

    Our product is built using PHP, Symfony, Vue ,PostgreSQL, AWS. We also use Redis, Vue Router, Vuex, Docker Compose, Docker, GitLab CI, and Graylog, and some third-party API's like Stripe. We use Slack, Clubhouse, Notion, Whimsical, Figma, and G Suite to collaborate and build together.

    Technology

    Current back-end tech stack:

    PHP Laravel PostgreSQL Docker (Compose and Swarm) GitLab CI AWS S3 AWS EC2 GreyLog

    Current front-end tech stack:

    Vue (and Vue-Router) Vuex 3rd party libs for GTM/Stripe/etc.

    Apply Now

    See more jobs at Firstbase.io

    Apply for this job

    +30d

    Engineering Manager - Growth

    ProtonMailLondon, Geneva, Zürich, Prague, Vilnius, Barcelona;, Switzerland, Remote
    sqltailwindDesignmetalsasssymfonymysqlcssjavascriptPHP

    ProtonMail is hiring a Remote Engineering Manager - Growth

    At Proton, we envision an internet where privacy is the default, and we’re building ways to help all people secure their digital lives and take control of their data. ProtonMail was founded in 2014 by a group of scientists who met at the European Organization for Nuclear Research (CERN). And since its inception, the company has grown at a fast pace and today has over 40 million users.

    Our principal product, ProtonMail, is the world’s largest secure email service. Our second product, ProtonVPN, is one of the world’s most popular VPN services. Our vision is to build an internet platform for the protection of digital rights, and we are also developing additional products, including ProtonCalendar, ProtonDrive, and more to come.

    Our users include New York Times journalists, some of the world’s largest corporations, and millions of ordinary citizens. The world is adopting our products at an accelerating pace. Whether it’s in New York, or at the front lines of the global struggle for freedom and democracy in Hong Kong, Belarus, and Myanmar, the work we do saves lives and is transforming the world. Our team is diverse and dynamic, representing over 30 different nationalities, with offices in Geneva, Zurich, Prague, London, Vilnius, Skopje, and Taipei, employing people around the world.

    Proton is a mission driven company. We’re deeply committed to enabling freedom online and ensuring the internet serves the interests of all people. Our technologies provide trusted ways for people to be secure online and in control of their information at all times. The world is adopting our products at an accelerating pace. Help us bring it from tens of millions of users, to billions of users. We’re creating one of the world’s most impactful tech companies.

    Purpose of the role
    As a leader within the Growth Engineering team, you will manage a cross-functional team of engineers that has direct responsibility of reaching millions of new customers and onboarding them into our product ecosystem. You will lead design and development of systems pertaining to acquisition, onboarding, activation, and engagement while creating great user experiences at scale. As a member of the Growth leadership team you will partner with Product and Marketing to refine our growth strategies, design experiments that discover and validate customer hypotheses, and optimize our customer experiences to drive engagement and keep our existing customers happy. You will report directly to the VP of Engineering.


    What you will do

    • Collaborate with senior leadership and your peers to develop the strategy for your team
    • Lead and participate in technical design and product discussions with leaders across the company
    • Hire, develop, and coach engineers, and help them learn and grow to achieve their goals
    • Hold yourself and your team accountable to high engineering standards
    • Guide your team to continuously improve our systems towards greater observability and resiliency
    • Develop efficient processes, instill a sense of urgency, and motivate your team to operate with high velocity, ownership, and accountability
    • Build products, systems, and services that solve your customers' problems
    • Foster an inclusive environment for your team to show up and give their best each day
    • Contribute to the broader technology and open source communities


    Technologies we use and teach

    • Javascript, React, Gatsby
    • PHP, Symfony
    • SQL, MySQL, Kafka, Redis
    • Event driven architecture

      See more jobs at ProtonMail

      Apply for this job

      +30d

      Senior Developer (PHP)

      IQ EQ3 More London Riverside, 3 More London Riverside, London SE1 2RE, UK, Remote
      agilejiranosqlRabbitMQlaravelapisymfonybackendPHP

      IQ EQ is hiring a Remote Senior Developer (PHP)

      Company Description

      Do you want to be part of a Global Private Equity Administrator who provides outsourced Administration services for PE, Real Estate, Depository and Compliance with Assets under Administration in the excess of $650Billion? If so, please read on!

      With offices across 23 jurisdictions including New York, London, Paris, Amsterdam, Cayman, BVI, Belfast, Dublin, Guernsey, Jersey, Luxembourg, Netherlands, Cyprus, Mauritius, Singapore, Hong Kong and Manila our growth journey has only just begun. 

      Job Description

      As our key Senior Developer you will report directly to our Head of R&D. You will be working on the continuous development of the proprietary RegTech software solution, MaxComply, in an Agile environment. You will be largely working on a LAMP based technology stack using the PHP framework Symfony 5.4 and above, for developing the backend microservices.

      Key Responsibilities:

      • Work as part of a dynamic development team on the forefront of PHP application development
      • Contributing to the continuing development of the software architecture of MaxComply
      • Finding code solutions to business process specifications by programming new software modules, with exposure to the full technology stack
      • Resolving bug fix tickets on the internally developed code base
      • Liaising with superusers to identify and specify business requirements for new features
      • Show an awareness of ongoing security risks and solutions
      • Write well-structured, clean, and efficient code, in line with OOP SOLID principles

      Qualifications

      • 3-5 years commercial software development experience in PHP
      • At least 3 years’ experience in one of the modern PHP frameworks (experience with Symfony or Laravel is a plus)
      • At least 2 years’ experience in the Agile/Scrum development methodology
      • Understanding of microservice approach to application development
      • Understanding of OOP SOLID principles
      • Good understanding of designing robust REST API
      • Experience writing automated unit tests
      • Experience working with relational databases
      • Knowledge of NoSQL databases is a plus
      • Experience with queueing systems (RabbitMQ) is a plus
      • Experience with caching systems is a plus
      • Exposure to IDE environments and Continuous Integration tools (Bitbucket, Jira etc)
      • An understanding of financial compliance processes is not necessary, but a willingness to learn and understand business workflows is essential
      • Excellent verbal and oral communication skills 
      • Enthusiasm to grow and learn from experienced colleagues
      • Process oriented working style with clear goal direction and output focus

      Additional Information

      At IQ-EQ we want you to reach your full potential. We offer an inclusive and diverse environment to support your career aspirations. With a strong emphasis on continuous learning and a holistic approach to your professional and personal development. We also offer opportunities across our service lines and our international network of offices.

      If you are looking for a role where you will be given the opportunity to bring fresh ideas, drive forward improvements with a willingness to learn, develop and keep abreast of technological developments, we would love to hear from you!

      If you would like to take on this exciting challenge, please apply today for immediate consideration.

      See more jobs at IQ EQ

      Apply for this job

      +30d

      Senior PHP Engineer (AMO)

      GenesisKyiv, UA Remote
      RabbitMQmongodbapisymfonyjavadockerelasticsearchpostgresqlmysqlkuberneteslinuxpythonAWSPHP

      Genesis is hiring a Remote Senior PHP Engineer (AMO)

      AMO— міжнародна IT-компанія, яка створює продукти та історії для мільйонів користувачів.

      Має три великі команди: AMO Publishing, AMO Pictures та AMO Apps.

      Ми знаходимось в пошуку Senior PHP Engineer, який разом з командою буде розвивати і покращувати наші продукти Health&Fitness напрямку.

      Наш стек:PHP 8, Symfony 5, MySQL 8, MongoDB, Redis, Memcached, RabbitMQ, Kafka, ElasticSearch, Docker, Kubernetes, AWS.

      Твоїми задачами будуть:

      • Розробка API
      • Оптимізація та рефакторинг сервісів додатків
      • Участь у прийнятті архітектурних рішень, коду рев’ю
      • Взаємодія з продуктовою та веб-командами

      Необхідні навички та досвід:

      • 5+ роки досвіду розробки програмного забезпечення
      • Добре володіння PHP7+
      • Знання будь-якого PHP фреймворку (Symfony/Yii/Laravel)
      • Досвід з базами MySQL або PostgreSQL
      • Досвід роботи з кешем (Memcached або Redis)
      • Досвід роботи з чергами (RabbitMQ або Kafka)
      • Досвід з мікросервісною архітектурою

      Буде перевагою, якщо ти:

      • Маєш досвід роботи з Symfony
      • Маєш досвід з іншими мовами програмування (Go, Python, Java etc)
      • Гарно розумієш принципи OOР, SOLID
      • Маєш досвід роботи з Linux, хмарними провайдерами (AWS), Kubernetes, ElasticSearch, MongoDB
      • Вмієш будувати відмовостійку систему високого навантаження
      • Маєш знання монолітних, сервіс-орієнтованих архітектур та їх шаблонів

      Чекаємо на твоє резюме!



      See more jobs at Genesis

      Apply for this job

      +30d

      Symfony Developer (Mid-Senior-Techlead)

      DropticaRemote job, Remote
      sqlB2BdrupalvuejquerysymfonymysqlcssangularjavascriptreactjsPHP

      Droptica is hiring a Remote Symfony Developer (Mid-Senior-Techlead)

      Joining Droptica means:

      • Working with technologies: PHP, MySQL, JavaScript, jQuery, HTML, CSS, SCSS, Twig, bootstrap, patternlab,
        Drupal.
      • Work with clients from all over the world.
      • Possibility of developing and promoting Open Source software.
      • Work in one of the best companies that deliver big websites based on Drupal.
      • Regular trainings: access to video materials, books, internal trainings.
      • Yearly budget for individual education.
      • Focus on quality of work (code review, retro, architecture planning. etc.)
      • Flexible working hours.
      • Free health service (PZU)
      • Multisport cart.
      • Help with relocation (Poland Business Harbour program)

      Location:

       One of our offices: Wrocław, Gdańsk, Toruń, Rzeszów or 100% remotely from Poland

      Requirements:

      • 3+ years of experience with  Symfony
      • Good knowledge of HTML, CSS, JS, JQuery, and SQL
      • You can communicate in English well (B2 level)

      Nice to have

      • Drupal certificates
      • ReactJS, Angular, Vue


      See more jobs at Droptica

      Apply for this job

      +30d

      Mid/Senior PHP Developer (Symfony) (14.000 zł - 24.000 zł net)

      SurvicateRemote job, Remote
      3 years of experienceremote-firstsqlsymfonypostgresqlAWSbackendPHP

      Survicate is hiring a Remote Mid/Senior PHP Developer (Symfony) (14.000 zł - 24.000 zł net)

      In this role, you’ll use your extensive knowledge of PHP and related frameworks like Symfony to improve Survicate surveys seen by over 1,000 people per minute. You’ll engineer for usability, scalability, maintainability, and performance. The release of a new feature makes a huge impact on how easily thousands of companies around the world are able to collect and act upon collected feedback. Fixing even the tiniest bug means improving the user experience for thousands of respondents.

      We work in an autonomous, cross-skilled product team that consists of Front-end and Backend Developers, QAs, Product Designers, and  Product Managers. We love collaboration, discussing product ideas, creating the best possible solution as fast as possible, and getting it released.

      Our stack:

      • Architecture: Microservices
      • Infrastructure: AWS
      • Most of the services are written in PHP7 using the Symfony framework
      • Database: PostgreSQL
      • Cache: Redis
      • Queue: SQS (for background jobs)
      • Auto deployments
      • Containerization

      In a typical week as a backend engineer at Survicate you’ll:

      • Write code that will impact thousands of people every day
      • Collaborate with front-end engineers to spec, write, test, and deploy code.
      • Brainstorm features with product managers and designers and guides decisions based on your knowledge of the codebase
      • Maintain the project by regular updates and code housekeeping
      • Assist our skilled Customer Success team in triaging bugs and solving issues in production in your primary area
      • Learn about and use new web technologies
      • Like the work you do, enjoy collaborating with your coworkers, and finish work on time

      See more jobs at Survicate

      Apply for this job

      +30d

      PHP Application Developer

      Oyova Software, LLC1719 Penman Rd, Jacksonville Beach, FL 32250, USA, Remote
      agilewordpresslaravelDesignsymfonytypescriptreactjsPHP

      Oyova Software, LLC is hiring a Remote PHP Application Developer

      Company Description

      Oyova is a web and application development and marketing agency that began in 2008. With a team of 27 strategists and actual do-ers, we transform organizations. We work in all technologies and design the best solution for the problem. We are agile, adaptable, flexible, and are all problem solvers. Our clients look to us to solve their complex challenges and we don't give up until we do.

      Our approach is consultative. We integrate marketing and technology to create efficiencies and growth. And we play nice with others. We work with over 50 other marketing agencies across the US, where they trust us to deliver on behalf of their clients.

      Job Description

      Oyova Software is looking for a self-sufficient, mid to senior level, motivated developer looking to grow in skills with a growing company and team. Opportunity to grow within the company, but not required characteristics. Individual should have strong problem solving skills, be solutions oriented with solid communication skills, and a solid understanding of PHP frameworks.

      If you like to work on a variety of projects and learn in a fast-paced environment, you may be a solid fit.

      Qualifications

      Required Experience

      • Custom PHP Application Development
      • Experience with PHP Frameworks
      • Laravel MVC Framework
      • Laravel Vapor

      Optional Related Experience

      • CodeIgniter
      • Symfony
      • Laravel Nova
      • Laravel Sanctum
      • Laravel Lumen
      • Other PHP or application frameworks

      Nice-to-have Experience

      • ReactJS
      • TypeScript
      • VueJS
      • WordPress
        • Custom Themes
        • Custom Plugins

      Additional Information

        This posting is for a Full-time remote position working during EST hours. We look forward to receiving your application!

        All your information will be kept confidential according to EEO guidelines.

        If interested, please respond with your:

        • FT SALARY REQUIREMENTS
        • AVAILABILITY TO INTERVIEW/START?
        • A TIME TO CONTACT YOU?
        • A COPY OF YOUR  RESUME (Word/PDF).

        Oyova Software - Jacksonville Beach, FL

        See more jobs at Oyova Software, LLC

        Apply for this job

        +30d

        Senior DevOps Engineer (Location Flexible)

        kotlinterraformlaravelDesignansiblemongodbsymfonydockerelasticsearchmysqltypescriptkuberneteslinuxpythonreduxbackendfrontendPHP

        ALYCE, INC. is hiring a Remote Senior DevOps Engineer (Location Flexible)


         


        Senior DevOps Job Description

        About Alyce

        Hi — we’re Alyce! Founded in 2015 with a tiny team sharing space with a bike repair shop, we’ve grown up in more ways than one. You can now find us across the globe with roots in Boston. 

        Every year $242B is spent on corporate gifts, swag and direct mail. It’s the most relational channel and we’re on a mission to make it personal, relevant and simply, a magical experience. No more squishy balls, cheap water bottles, and other things that end up in the trash. As the only Smart Gifting Platform™, we flip the script by putting the recipient in control — creating authentic personal moments. This is how modern businesses grow sustainably at scale.

        We value our people above everything else. While we all have our own passions, personalities, objectives, and goals, we are one team that is building something great together. Our differences make us collectively better. We strive to build a supportive and inclusive environment where our team members are recognized and valued for who they are during working hours (9-to-5) and outside of them (#5to9™).

        And we’re proud and honored to be recognized asComparably’s Best Company for Women, Best Company Culture and Best Places to Work in Boston, as well as Bostinno’s 50 on Fire, LinkedIn’s Top 50 Start-Ups of 2020 andForbes2021 Best Start-Up Employer.

        About this position

        Alyce is currently seeking an experienced Senior DevOps Engineer to join our growing team andcontribute to the development and maintenance of Alyce's infrastructure. You will take direct ownership of part of our platform that provides the infrastructure, core capabilities and expertise to enable our product team to deliver at pace.

        This is an integral position within our technical organization that will enable you to gain exposure into a fast-paced SaaS company with ample opportunities for career growth. We are looking for hard-working, competitive, and self-driven individuals who are looking to apply their skills and drive deep impact in our technical organization to create the best application environment.

        How you’ll make Alyce amazing:

        • Work with Engineering Leaders to design, develop and deploy our infrastructure as we add new products, features and services
        • Develop and maintain an active codebase in Python, HCL
        • Configure and manage Linux-based tools
        • Identify manual processes that can be automated
        • Champion best practices and standards within the team and in the broader technical organization
        • Respond to alerts, and resolve or escalate system issues as necessary
        • Drive results in an environment that leverages modern application development (such as Docker, Kubernetes,Terraform, PaaS and SaaS services)
        • Collaborate with product and product facing engineering teams to enable their success
        • Work with team members to ensure the safety of Alyce's users' data as well as compliance with GDPR, PCI, etc.
        • Communicate clearly and enjoy the learning process while deploying and scaling new technologies as a proponent of automation/infrastructure of code

        How you will up-level Alyce: 

        • 4+ years of experience as DevOps engineer
        • 2+ years of experience in Google Cloud Platform in large or medium-sized organizations. 
        • Strong knowledge and experience with Kubernetes
        • Experience with Infrastructure as Code such as Terraform, Ansible
        • 1+ year of successful experience using Python as a programming language for automation
        • A huge plus if you have any exposure to ElasticSearch or HashiCorp Vault
        • Comfortable working in an evolving start-up environment with a Global team, helping to build new and iterate on existing processes as well as try new approaches

        Our Tech Stack:

        • Infrastructure:
          Google Cloud Platform: Kubernetes Engine, Memorystore for Redis, CloudSQL for MySQL, Compute Engine, Cloud Storage
        • Other managed platforms: MongoDB Atlas, Elastic Cloud
        • Secrets management: Automatic rotation and distribution using HashiCorp Vault
          CI/CD: GitLab, Helm
        • Infrastructure as Code: Terraform, Ansible
        • Monitoring & Logging: Prometheus, Grafana, DataDog, ElasticSearch
        • Frontend: React, Redux, Typescript, styled, RxJS, Webpack, Yarn, Vue.js
        • Backend: PHP, Go, Python, Laravel, Symfony
        • QA/AT: Kotlin, Groovy

        We firmly believe our differences make us collectively better. Alyce is committed to building a team that is diverse in background and experience. Alyce recognizes Diversity as the presence of differences that may include race, gender, religion, sexual orientation, ethnicity, nationality, socioeconomic status, language, (dis)ability, age, religious commitment, or political perspective. Diversity also includes differences in principles, values, thoughts, and beliefs. Diversity of thought and experience are vital to building a personal Alyce experience, representative of the world in which we live.

        Please do not let doubt get in the way of applying for this position. If you can demonstrate the abilities listed above, we want to hear from you.

         

         

        See more jobs at ALYCE, INC.

        Apply for this job

        +30d

        Solutions Architect (Québec)

        Publicis Sapient330 Rue Saint-Vallier E, Québec, QC G1K 9C5, Canada, Remote
        agiledrupallaravelDesignvueazuresymfonygitswaggerdockermysqlangularjenkinsAWSNode.jsPHP

        Publicis Sapient is hiring a Remote Solutions Architect (Québec)

        Job Description

        Nurun is looking for a Solutions Architect. The ideal candidate is stimulated and has the ability to design digital solution architectures for different clients around the world. The Solutions Architect is the technical reference for day-to-day development teams. This person will contribute to the technological vision and the service offering of the company by participating in daily brainstorming sessions in order to propose new ideas and tools. 

        Your day-to-day involves

        • Being the technical reference for the development and architecture of our solutions;
        • Mitigating risks and implementing robust solutions while taking various constraints into consideration;
        • Contributing to the technological vision and service offer of the agency;
        • Producing proofs of concept to validate hypotheses;
        • Defining the technological architecture of a system in detail (components, products integration, servers, security, etc.);
        • Participating in brainstorming sessions and bringing forth ideas on tools and technologies;
        • Documenting the technical specifications and implementation details of a project;
        • Being in a position to offer technical support (and mentoring) to the developers;
        • Participating in the planning and analysis of new functionalities to develop.

        Condition for success 

        • University degree in Computer Science or the equivalent relevant experience;
        • Highly experienced in PHP;
        • Skilled in the following technologies: PHP (Drupal, Doctrine, Symfony, Laravel), Node.js, XDebug, Vagrant, Docker, GIT, JSON, AJAX, Composer, Nexus, Jenkins, SonarQube, and CI/CD processes;
        • Knowledge of front-end frameworks, such as Vue, and Angular;
        • Skilled working with MySQL and relational databases;
        • In-depth knowledge of infrastructure and DevOps;
        • Ability to intervene in all phases of a project, from specifications to tests;
        • A sense of leadership and at ease communicating concepts;
        • Bilingual (French and English).
        • Knowledge of cloud platforms, such as AWS, Azure, Google, and Acquia.

        Nice extras 

        • Knowledge of major CRM platforms;
        • Knowledge of Swagger;
        • Knowledge of CraftCMS and Yii framework;
        • Knowledge of container deployments like Kubernetes.

        Additional Information

        Why Nurun?

        • Large-scale digital projects for major clients around the world;
        • A competitive offer and wide range of social benefits from day one;
        • A hybrid Agile methodology enriched by collaboration with passionate experts;
        • The option of working 100% remotely, with access to a collaborative office space;
        • A flexible schedule that truly allows work-life balance; 
        • A personalized development plan supported by our continuing education platforms.

        Who we are

        Nurun crafts useful digital experiences that elevate brands and transform businesses. From creating products and services to data science and human research, we take the best of agility and apply a hybrid approach to adapt to the needs of our clients. Even after delivery, our involvement does not stop. We push the limits of technology to evolve and optimize our products and their performance. Curious to know more? Visit us on Instagram and LinkedIn.

        +30d

        Solutions Architect (Montreal)

        Publicis SapientAv. Beaubien O, Montréal, QC H2V, Canada, Remote
        agiledrupallaravelDesignvueazuresymfonygitswaggerdockermysqlangularjenkinsAWSNode.jsPHP

        Publicis Sapient is hiring a Remote Solutions Architect (Montreal)

        Job Description

        Nurun is looking for a Solutions Architect. The ideal candidate is stimulated and has the ability to design digital solution architectures for different clients around the world. The Solutions Architect is the technical reference for day-to-day development teams. This person will contribute to the technological vision and the service offering of the company by participating in daily brainstorming sessions in order to propose new ideas and tools. 

        Your day-to-day involves

        • Being the technical reference for the development and architecture of our solutions;
        • Mitigating risks and implementing robust solutions while taking various constraints into consideration;
        • Contributing to the technological vision and service offer of the agency;
        • Producing proofs of concept to validate hypotheses;
        • Defining the technological architecture of a system in detail (components, products integration, servers, security, etc.);
        • Participating in brainstorming sessions and bringing forth ideas on tools and technologies;
        • Documenting the technical specifications and implementation details of a project;
        • Being in a position to offer technical support (and mentoring) to the developers;
        • Participating in the planning and analysis of new functionalities to develop.

        Condition for success 

        • University degree in Computer Science or the equivalent relevant experience;
        • Highly experienced in PHP;
        • Skilled in the following technologies: PHP (Drupal, Doctrine, Symfony, Laravel), Node.js, XDebug, Vagrant, Docker, GIT, JSON, AJAX, Composer, Nexus, Jenkins, SonarQube, and CI/CD processes;
        • Knowledge of front-end frameworks, such as Vue, and Angular;
        • Skilled working with MySQL and relational databases;
        • In-depth knowledge of infrastructure and DevOps;
        • Ability to intervene in all phases of a project, from specifications to tests;
        • A sense of leadership and at ease communicating concepts;
        • Bilingual (French and English).
        • Knowledge of cloud platforms, such as AWS, Azure, Google, and Acquia.

        Nice extras 

        • Knowledge of major CRM platforms;
        • Knowledge of Swagger;
        • Knowledge of CraftCMS and Yii framework;
        • Knowledge of container deployments like Kubernetes.

        Additional Information

        Why Nurun?

        • Large-scale digital projects for major clients around the world;
        • A competitive offer and wide range of social benefits from day one;
        • A hybrid Agile methodology enriched by collaboration with passionate experts;
        • The option of working 100% remotely, with access to a collaborative office space;
        • A flexible schedule that truly allows work-life balance; 
        • A personalized development plan supported by our continuing education platforms.

        Who we are

        Nurun crafts useful digital experiences that elevate brands and transform businesses. From creating products and services to data science and human research, we take the best of agility and apply a hybrid approach to adapt to the needs of our clients. Even after delivery, our involvement does not stop. We push the limits of technology to evolve and optimize our products and their performance. Curious to know more? Visit us on Instagram and LinkedIn.

        +30d

        Solutions Architect (Toronto)

        Publicis Sapient111 Queen St E, Toronto, ON M5C 1S1, Canada, Remote
        agiledrupallaravelDesignvueazuresymfonygitswaggerdockermysqlangularjenkinsAWSNode.jsPHP

        Publicis Sapient is hiring a Remote Solutions Architect (Toronto)

        Job Description

        Nurun is looking for a Solutions Architect. The ideal candidate is stimulated and has the ability to design digital solution architectures for different clients around the world. The Solutions Architect is the technical reference for day-to-day development teams. This person will contribute to the technological vision and the service offering of the company by participating in daily brainstorming sessions in order to propose new ideas and tools. 

        Your day-to-day involves

        • Being the technical reference for the development and architecture of our solutions;
        • Mitigating risks and implementing robust solutions while taking various constraints into consideration;
        • Contributing to the technological vision and service offer of the agency;
        • Producing proofs of concept to validate hypotheses;
        • Defining the technological architecture of a system in detail (components, products integration, servers, security, etc.);
        • Participating in brainstorming sessions and bringing forth ideas on tools and technologies;
        • Documenting the technical specifications and implementation details of a project;
        • Being in a position to offer technical support (and mentoring) to the developers;
        • Participating in the planning and analysis of new functionalities to develop.

        Condition for success 

        • University degree in Computer Science or the equivalent relevant experience;
        • Highly experienced in PHP;
        • Skilled in the following technologies: PHP (Drupal, Doctrine, Symfony, Laravel), Node.js, XDebug, Vagrant, Docker, GIT, JSON, AJAX, Composer, Nexus, Jenkins, SonarQube, and CI/CD processes;
        • Knowledge of front-end frameworks, such as Vue, and Angular;
        • Skilled working with MySQL and relational databases;
        • In-depth knowledge of infrastructure and DevOps;
        • Ability to intervene in all phases of a project, from specifications to tests;
        • A sense of leadership and at ease communicating concepts;
        • Bilingual (French and English).
        • Knowledge of cloud platforms, such as AWS, Azure, Google, and Acquia.

        Nice extras 

        • Knowledge of major CRM platforms;
        • Knowledge of Swagger;
        • Knowledge of CraftCMS and Yii framework;
        • Knowledge of container deployments like Kubernetes.

        Additional Information

        Why Nurun?

        • Large-scale digital projects for major clients around the world;
        • A competitive offer and wide range of social benefits from day one;
        • A hybrid Agile methodology enriched by collaboration with passionate experts;
        • The option of working 100% remotely, with access to a collaborative office space;
        • A flexible schedule that truly allows work-life balance; 
        • A personalized development plan supported by our continuing education platforms.

        Who we are

        Nurun crafts useful digital experiences that elevate brands and transform businesses. From creating products and services to data science and human research, we take the best of agility and apply a hybrid approach to adapt to the needs of our clients. Even after delivery, our involvement does not stop. We push the limits of technology to evolve and optimize our products and their performance. Curious to know more? Visit us on Instagram and LinkedIn.

        +30d

        Senior and Mid Backend Developers (ISG) (f/m/d) Spain

        SIGNA Sports UnitedBarcelona, Spain, Remote
        agileRabbitMQDesignsymfonydockermysqlkubernetesbackendPHP

        SIGNA Sports United is hiring a Remote Senior and Mid Backend Developers (ISG) (f/m/d) Spain

        Company Description

        SIGNA Sports United (SSU) has built the global #1 sports e-commerce & technology platform with market leading positions in Bike, Tennis, Outdoor & Team Sports. We are leveraging our unique tech and operating platform to power our leading online stores like Fahrrad.de, Bikester, Probikeshop, Tennis-Point, Outfitter, and many more. 
         
        SSU is firmly in growth mode, so far in 2021, we have entered the US market with the acquisitions of Tennis Express and Midwest sports, two of the largest tennis platforms in the US, we have acquired WiggleCRC, a global bike retailer, thus creating the biggest online bike retailer in the world. On 15.12.21 Signa Sports United has successfully floated on the New York Stock exchange and is now a publicly traded Company.  

        Our growth has been propelled by acquiring new Brands in leading sports businesses and scaling our current portfolio through our end-to-end e-commerce as-a-service solutions, connecting & enabling offline specialist retailers and integrating with digital sports communities.  

        Joining SSU would mean you will be part of high-calibre team, united by passion, driven by innovation, and pioneers in the Sports & Outdoors arena. Have the power to have tremendous impact and be a part of a team that fosters growth, leadership, community and transformation.

        Job Description

        What you will be responsible for

        • You will support the Logistic and Order Management Squad for the technical transformation from a monolith to a service-based infrastructure.
        • We take care of the complete order flow up to complex logistical processes.
        • You will be part of an agile team that takes all decisions together and works independently on solutions. You can find more information in the article: https://cutt.ly/internetstores-agile
        • You will also have to do maintenance tasks in our legacy monolith. We look in the team that these tasks are well distributed.
        • You will also support code reviews and improve our services and processes.

        Qualifications

        What we're looking for

        • 5+ years of experience in software development
        • 3+ years of experience working with PHP
        • 2+ years of experience with latest Symfony versions, other popular frameworks are considered
        • Experience building RESTful APIs
        • Experience with message queuing
        • 3+ years of experience working with MySQL, other relational databases can be considered
        • Good code design, OO principles, Unit/Functional testing, SOLID, and KISS
        • Experienced in building scalable systems
        • Bonus points for Docker, Kubernetes, Mulesoft, RabbitMQ, Kafka, Mongo, Go, TDD, DDD)
        • You are self-organized and passionate to work in an agile environment

        Additional Information

        What we offer:

        • Competitive compensation 
        • 25 days annual holiday + public bank holiday’s 
        • 800€ Workplace budget the first year + 200€ the rest
        • 1.500€ Personal development budget per year
        • Private medical insurance
        • Flexible working hours 
        • Remote (within Spain)

        #LI-Remote

        See more jobs at SIGNA Sports United

        Apply for this job