Back End Software Engineer Remote Jobs

94 Results

2d

Node js Developer

agilesqlhtml5javascriptNode.js

Zealogics.com is hiring a Remote Node js Developer

Node js Developer - Zealogics.com - Career Page

See more jobs at Zealogics.com

Apply for this job

3d

Back-End Software Engineer

sqlapijavamysqlAWS

Movemedical is hiring a Remote Back-End Software Engineer

Back-End Software Engineer - Movemedical - Career Page

See more jobs at Movemedical

Apply for this job

3d

Senior Back-End Software Engineer

agilesqlDesignapijavamysqlAWS

Movemedical is hiring a Remote Senior Back-End Software Engineer

Senior Back-End Software Engineer - Movemedical - Career Page

See more jobs at Movemedical

Apply for this job

8d

Backend Engineer

GistiaSao Paulo, BR Remote
5 years of experience3 years of experiencenosqlsqlsalesforceDesignansiblemongodbgitjavadockermysqltypescriptjavascriptbackendNode.js

Gistia is hiring a Remote Backend Engineer

High-level Criteria:

Skills:Node JS, Java

Level:Senior

Approx wage:~45-55K USD / year

Key aspects:Must have previously played a Team Lead and/or Engineering Manager role

Keyword Search:

  • Senior Software Engineer, Backend Software Engineer, Software Engineer, Software Developer, Senior-level Developer
  • Titles including Senior, Backend, SQL
  • Production Support, technical business analysis, Mongodb knowledge

Job overview:

Gistia helps organizations deliver high-quality healthcare enterprise solutions in a timely manner through our internal processes and methods. And this is an opportunity to join our team of talented individuals focused on using innovative technologies to address complex real-world problems currently impacting our clients.

We are looking for a seasoned Backend Software Engineer to be responsible for solving complex engineering challenges and for designing and developing critical and innovative applications.

You’ll need to be at least acquainted with these common programming skills: Javascript, TypeScript, Node.js, Java, SQL and NoSQL databases, Express, automated unit and integration tests, code versioning, background job processing, experience with systems design, run peer code reviews and understand the best practices for all.

This is a remote, full-time position and you will work with an internationally distributed project team and client, so good communication skills are required.

Responsibilities and Duties:

  • Ability to hear and translate business requirements into technical terms or architecture design
  • Rigorously develop, test, and document code.
  • Enhance existing solutions to improve performance
  • Be curious to explore and quickly react to emerging technologies
  • Proactively foster a respectful workplace culture within the team
  • Availability to work remotely and available 9am - 5pm EST
  • Possess own equipment, with high-speed internet access and high-quality camera/headset

Specific Skills:

  • Experience working with an Agile/Scrum based development model
  • Experience using Git and the usual development pipeline tools
  • Experience making decisions regarding application architecture
  • Have exceptional knowledge and experience with back-end technologies (Node.js and/or Java)
  • Experience developing REST based APIs design (JSON, XML, etc.)
  • Experience with Relational (MySql, SQL Server, etc.) and Non-relational Database (e.g., MongoDB)
  • Experience with DevOps/Deployment Tools (Ansible, Docker, etc.)
  • Familiarity with automated testing (TDD, Mocking, Unit/Functional/Integration)

Personal Characteristics:

  • Good verbal and written communication skills (English)
  • Ability to be client facing to manage communications surrounding issues, bugs, investigations in production or other environments
  • Have an appreciation for the peace of mind that comes with well-tested, documented code
  • Be self-directed and able to manage your time effectively
  • Ability to handle multiple tasks concurrently

Nice to have:

  • Have analytical and troubleshooting skills
  • Experience with Salesforce development (Apex, SOQL, SOSL, VisualForce, Lightning Web Components, etc.)
  • Experience in the US Healthcare business field


Qualifications:

Education level:BS degree in Computer Science, Engineering, or related field.

Experience:

  • (Mid-level) +3 years of experience, having built, delivered, and maintained at least 2-3 applications, back to front.
  • (Senior level) +5 years of experience, having built, delivered, and maintained at least 4-6 applications, back to front.

Benefits

Join our incredibly talented team on a mission to radically transform the future of healthcare! Rapidly develop your career in software development alongside a company at the forefront of machine learning; Gistia Healthcare is a leading provider of artificial intelligence products and services that help balance the playing field between providers and payers. Become a vital part of something truly transformative as we embrace the endless opportunities for improvement in the US Healthcare Industry. Gistia offers competitive compensation and benefits, including unlimited vacation time, remote working environment, small intimate teams, and English tutoring for non-native speakers.

See more jobs at Gistia

Apply for this job

+30d

Elixir Developer

agileDesigngraphqlscrumrubylinuxNode.js

Koombea Inc is hiring a Remote Elixir Developer

Elixir Developer - Koombea Inc - Career PageSee more jobs at Koombea Inc

Apply for this job

+30d

Backend Software Developer

agileDesignpytestscrumjenkinspythonbackend

Optel Group is hiring a Remote Backend Software Developer

Backend Software Developer - Optel Group - Career Page<

See more jobs at Optel Group

Apply for this job

+30d

Développeur logiciel Backend

agileDesignpytestscrumjenkinspythonbackend

Optel Group is hiring a Remote Développeur logiciel Backend

Développeur logiciel Backend - Optel Group - Career PageOPTEL est une entreprise internationale qui développe, pour des clients basés, pour la plupart, à l’extérieur du Canada, des solutions logicielles

See more jobs at Optel Group

Apply for this job

+30d

Drupal Backend Developer Sr

mariadbsalesforcedrupalfreelanceapimysqlbackend

Axxon Consulting is hiring a Remote Drupal Backend Developer Sr

Drupal Backend Developer Sr - Axxon Consulting - Career Page

See more jobs at Axxon Consulting

Apply for this job

+30d

Senior Backend Software Engineer

Greenlight GuruRemote, Indiana, United States
Designgitbackend

Greenlight Guru is hiring a Remote Senior Backend Software Engineer

Greenlight Guru is a software company that helps some of the world’s most innovative medical device companies design, develop and advance the success of devices that improve and extend the lives of millions of people across the globe. Having raised over $120M from top-tier investors, we are rapidly scaling with a driven and relentless commitment to helping our customers succeed. Consistently recognized as the Best Place to Work by Inc. Magazine, the Indy Star, and more, our culture is centered around improving the quality of life for everyone we come in contact with while fostering a fun, inclusive, high-performance environment.


Our innovative SaaS offering is beginning to revolutionize the way medical device companies invent, design, manufacture, sell, and support their products. With a consistent focus on providing fanatical support for our clients, being innovative, and fostering a culture of closing. Greenlight Guru is poised for exceptional growth and looking for the right people to help facilitate this growth.


We’re looking for an experienced Senior Back End Software Engineer that is ready to get their hands dirty and enjoys mentoring other engineers. You will play a key role in everything from expanding and improving our current flagship product to building out additional features, micro-services, analytics platform functionality, and 3rd party integrations. This is a great opportunity to contribute to our technical designs, and to take initiative in helping improve team and technical practices.


Responsibilities

  • Design, develop, and test software that meets our internal standards of quality
  • Solve problems of high complexity within your area of expertise
  • Diagnose and Fix performance and optimization problems in existing codebases
  • Contribute to and maintain internal community projects
  • Maintain unit and integration tests suite for the code bases where you contribute
  • Consistently ship features with minimal guidance and review pull requests 
  • Follow and suggest improvements to the workflow processes for software delivery
  • Collaborate with engineers and R&D team members outside of your squad
  • Follow and enhance the standards for style, maintainability, and best practices for a high-scale web platform. Advocate for these standards in code reviews
  • Participate in the on-call rotation and understand and tune code based on usage and performance metrics of your features. 
  • Make and deliver on your work commitments in a timely manner
  • Accurately estimates level of effort for work and keep accurate records of progress and completion of work
  • Contribute to project plans by collaborating with your squad, consulting the broader R&D organization, and doing online research.  
  • Inform your development process by understanding the detailed functional requirements and non-functional considerations
  • Provide guidance and teach others in your area of expertise
  • Present your work to other members of the R&D organization
  • Contribute to overall project plans and your work by collaborating with your squad, consulting the broader R&D organization, and doing online research.  
  • Perform work on a multiple concurrent engineering efforts with minimal supervision
  • Create data model documentation and data flow diagrams for the software you create and improve


Requirements:

  • Positive and solution-oriented mindset
  • Effective communication skills: Regularly achieve consensus with peers, and clear status updates
  • Intellectually curious with a background in using data to measure and explore how to evolve our technology 
  • An inclination towards inclusion, candor, and transparency
  • 4+ years of professional software development experience
  • Developed on a commercial cloud services vendor
  • Ability to create a unit and integration test suite
  • Familiarity with Application Integration Protocols
  • Professional experience with Continuous Integration Pipelines and Automation
  • Professional experience using Git in a professional/workplace environment


Benefits:

  • Co-workers who care deeply about our mission to spur medical device innovation 
  • Flexible hours
  • Work from home options
  • Unlimited PTO
  • 3 months paid maternity leave
  • Health insurance
  • Disability insurance
  • 401k


Greenlight Guru is an Equal Opportunity Employer. Individuals seeking employment at Greenlight Guru are considered without regard to race, color, religion, national origin, age, sex, marital status, ancestry, physical or mental disability, veteran status, gender identity, or sexual orientation. 

See more jobs at Greenlight Guru

Apply for this job

+30d

Sr. Software Engineer - Backend

inFeedoRemote job, Remote
backendNode.js

inFeedo is hiring a Remote Sr. Software Engineer - Backend

We're looking for Badass Engineers who can take complete ownership of our engineering deliveries, operations, hustle, and get shit done to scale our product at inFeedo. We seek applicants with a passion to learn different technologies, a relentless attitude to juggling multiple problem statements at once, and good communication skills.

You will be a part of the engineering team responsible for upgrading Amber at inFeedo.


No. of positions: 1


What will you be doing?

  1. Work in a democratic environment where decisions are driven by logic.
  2. Building a product with the platform-level approach which has core components and adapters on top of it.
  3. Keeping all engineering fundamentals in mind and solving through first principles.
  4. Pattern recognition and solving through automating the mundane problems
  5. Consume complexity within and provide the best experience to the users.
  6. You will help the existing team to improve the reliability, stability, and quality of the application.
  7. You will contribute to inFeedo’s roadmap and help us build a one-of-a-kind employee engagement product.

Who will you work with?

See more jobs at inFeedo

Apply for this job

+30d

Software Engineer - Backend

inFeedoRemote job, Remote
backendNode.js

inFeedo is hiring a Remote Software Engineer - Backend

We're looking for Badass Engineers who can take complete ownership of our engineering deliveries, operations, hustle, and get shit done to scale our product at inFeedo. We seek applicants with a passion to learn different technologies, a relentless attitude to juggling multiple problem statements at once, and good communication skills.

You will be a part of the engineering team responsible for upgrading Amber at inFeedo.


No. of positions: 2


What will you be doing?

  1. Work in a democratic environment where decisions are driven by logic.
  2. Building a product with the platform-level approach which has core components and adapters on top of it.

  3. Keeping all engineering fundamentals in mind and solving through first principles.

  4. Pattern recognition and solving through automating the mundane problems

  5. Consume complexity within and provide the best experience to the users.

  6. You will help the existing team to improve the reliability, stability, and quality of the application.

  7. You will contribute to inFeedo’s roadmap and help us build a one-of-a-kind employee engagement product.

Who will you work with?

See more jobs at inFeedo

Apply for this job

+30d

Software Engineer [Backend - Java with Cloud] [India]

EgnyteMumbai, India or Remote, India
sqlDesignqajavalinuxpythonAWSbackend

Egnyte is hiring a Remote Software Engineer [Backend - Java with Cloud] [India]

Description

Egnyte is seeking an experienced Sr. Software Engineer to join our Software Engineering (Infrastructure) group. The Software Engineering (Infrastructure) group builds large distributed components and services that run Egnyte’s Cloud Platform. Our code serves billions of requests per day with sub-second latency in a fault-tolerant environment. Some of the responsibilities for this group include Egnyte’s Cloud File System, Object Store, Metadata Stores, Search Systems, Recommendations Systems, Synchronization, and intelligent caching of multi-petabyte datasets. We are looking for candidates with a shared passion for building large-scale distributed systems and a keen sense for tackling complexities that come with scaling through multiple orders of magnitude.

What You’ll Do (but is not limited to)

  • Design and develop highly-scalable elastic cloud architecture that seamlessly integrates with on-premises systems
  • Challenge and redefine existing architectural fundamentals in order to provide next level of performance and scalability; ability to foresee post-deployment design challenges, performance and scale bottlenecks
  • Work with multicultural, geographically distributed teams and closely coordinate with cross-functional teams in multiple time zones.
  • Deliver enterprise-grade products to customers and continuously work with engineering team to refine products in the field
  • Mentor interns and junior engineers, collaborate with Operations, and work closely with CTO on roadmap items
  • Extensive penetration testing to ensure security across a hybrid deployment between public/private cloud
  • Monitor and manage 3,000+ nodes using modern DevOps tools and APM solutions
  • Proactive performance and exception analysis

YourQualifications

  • 5+ years of relevant industry work Experience
  • Demonstrated success designing and developing complex systems
  • Expertise with multi-tenant, highly complex, cloud solutions
  • Experience owning all aspects of software engineering, from design to implementation, QA and maintenance.
  • Experience with the following technologies: Java, SQL, Linux, Python, HBase/BigTable
  • Data driven decision process
  • Relies on unit testing instead of manual QA
  • Knowledge of DevOps techniques
  • BS or MS degree in Computer Science or related field

Bonus Skills

  • Experience with Hybrid and/or on-premises solutions 
  • Experience in working with AWS or GCP
  • Experience with the following technologies:, Nginx, Haproxy, BigQuery, New Relic, Graphite, and/or Puppet
  • Security / Governance expertise

About Egnyte

In a content critical age, Egnyte fuels business growth by enabling content-rich business processes, while also providing organizations with visibility and control over their content assets. Egnyte’s cloud-native content services platform leverages the industry’s leading content intelligence engine to deliver a simple, secure, and vendor-neutral foundation for managing enterprise content across business applications and storage repositories. More than 16,000 customers trust Egnyte to enhance employee productivity, automate data management, and reduce file-sharing cost and complexity. Investors include Google Ventures, Kleiner Perkins, Caufield & Byers, and Goldman Sachs. For more information, visit www.egnyte.com

#LI-Remote 

See more jobs at Egnyte

Apply for this job

+30d

Backend Developer (PHP)

CoveSingapore, SG Remote
Bachelor's degree5 years of experiencewordpresstailwindlaravelDesignapigitmysqlcsslinuxbackendfrontendPHP

Cove is hiring a Remote Backend Developer (PHP)

About Cove: Cove is the new way to rent your home! We’re a co-living start-up making it easier and more affordable for young people to have a comfortable place they can call home with a seamless rental experience from end to end. We provide our tenants with stylishly furnished properties, in the most awesome locations in Singapore and Jakarta and make the whole rental process seamless from end to end. Our contract terms are flexible like our tenant’s lives and our rental prices include everything from utilities and wifi and weekly cleaning. What’s unique about Cove is that our tenants get matched with great flatmates and also have access to our community events around the city. Check us out for more exciting information at https://cove.sg.

At Cove we reward and praise strong performance and strive to produce zero-defect results. We always aim for excellence and to always have the mindset of continuous improvement. In achieving results, we still make work fun and we completely value our team as people, not just resources in which we display care as well as empathy. Celebrating success with our team is also our priority and we highly encourage integrity and transparency.

Job Title: Backend/Fullstack Developer (PHP)

Job Type: Permanent (Open to a remote position nearby GMT+8)

Start Date: ASAP

Reports To: Head of Engineering

Role Purpose:This role will support web development initiatives in the Company. We're open to having applications that can work equal to SGT (GMT+08).

Responsibilities:

  • Develop and maintain our Laravel backend and its integration with the Property Management System
  • Work with external APIs, build and maintain other integrations
    • Collaborate with other Tech team members to design and develop products and features
    • Produce clean and maintainable code

      Requirements:

      • Bachelor's Degree in Computer Science/math
      • 5 years of experience in PHP (PHP 7, Laravel/Symfony)
      • SOLID/KISS/DRY
      • MySQL, Redis
      • Experience in designing and building REST API
        • Unit testing
        • CI/CD, Linux, nginx, git
        • Have systemic thinking, proactivity, ability to work independently, following best practices, curiosity, and desire to constantly learn

        Nice to have:

        • Experience in Frontend (React.js, Next.js, Tailwind CSS)
        • WordPress

        What’s in it for You:

        Working for Cove gives you the opportunity to join an exciting young start-up incubated through Antler.co. In your role, you’ll have the opportunity to hit the ground running and take ownership from day one. We will always welcome your input and ideas and actively encourage your development. The team is fast-paced, hard-working, and expects results but we also highly value our employee engagement and are committed to a human and empathetic environment with plenty of fun thrown in.

        See more jobs at Cove

        Apply for this job

        +30d

        Senior Engineer, Backend

        Boll & BranchNYC/Summit, NJ Remote
        apiqabackend

        Boll & Branch is hiring a Remote Senior Engineer, Backend

        The Senior Engineer for the Backend team is an integral role to help ensure our systems are as performant, reliable, and secure as possible. You are a seasoned generalist that will build, maintain, and innovate system components across the stack. As such, you will ensure business operations run smoothly and customer experiences are pain free. This role for the company is critical to our growth as you’ll facilitate:

        • Building out new features to enhance our home grown Rails Application to be the central hub for our various 3rd party integrations.
        • Ensuring business continuity by aggressively testing our process and tools with automated testing suites.
        • Improving transparency into our systems via logging, monitoring, and alerting
        • Contributing to the growth and culture of the backend team

        This role reports into our Engineering Manager, Backend. However, you will own projects and work with cross-functional teams. You will collaborate with Tech leadership on defining milestones and identifying areas for improvement. As our team grows, you will help us identify, interview for, and mentor additional Backend Engineers.

        First YearObjectives:

        • Month 1: Familiarize yourself with the current development process for the Backend team, meet all key stakeholders, familiarize yourself with (and help monitor and modify) the infrastructure.
        • By Month 2: Continue to grow familiarity with the new integration hub by building upon a suite of automated tests and working with our QA Engineer to document workflows and processes. Add to our growing documentation of service integrations, monitors, dashboards, and alarms.
        • By Month 3: Help integrate more third party services into the new integration hub. This will include robust QA cycles and documentation.
        • By Month 6: Work across teams to understand client-facing feature requests and their requirements from our business systems and integrations, and implement solutions facilitating a best in class experience.
        • By Month 8: Lean into performance testing our infrastructure and integrations, and create meaningful dashboards, monitors, and alarms to keep us ahead of any potential issues ahead of the holidays.
        • By Month 10: Be plugged into the system to facilitate Holiday Sales support and troubleshoot issues with order flow, fulfillment, inventory, etc.
        • By Month 12: Identify opportunities for improvement in our services or processes and help place them in next year’s roadmap

        Competencies:

        • Ability to Deliver: You have a proven ability to deliver against the plan (Structured approach). The business will be relying on you and your expertise.
        • Can own their expertise:You own your area of expertise and your code. You can identify where work needs to be done and articulate it to the team for prioritization.
        • Can organize their code and cover with tests:You write readable, testable code with an emphasis on maintainability.
        • Communication - Support teammates with documentation and thoughtful discussion:You can effectively describe technical concepts, challenges, and issues to both peers and stakeholders. You can communicate your thoughts in various forms, from planning notes to engineering docs to demos.
        • Buy it vs build it:You know when to leverage open source/third party solutions over in house implementations, factoring in time, cost, reliability, security, etc.
        • Thoughtful with data in general, databases in particular:You model data in a way that is intuitive to understand and easy to ingest. You write performant queries when fetching from a data source.
        • Practiced in RESTful API development and consumption:You follow standard best practices when working with RESTful APIs. You are comfortable using tools to test and verify APIs.
        • Curious and at home solving challenging problems:You are passionate about building web based systems, staying current with modern architectures, and view a challenge as an opportunity.

        The primary location for this role is New York City or Summit, NJ, and we are also open to remote-based candidates who are based in the United States. We believe our business and our culture are strongest when we work together in person. We also know that it’s helpful to have flexibility to work remotely. Currently we are operating under a hybrid model whereby all teams work in an office a minimum of two days per week (Tuesdays/Wednesdays) and may be provided flexibility to work from home on other days. There may be times when you’re asked to work in our Summit, NJ headquarters because it’s in the best interest of our business or your team.

        The annual base salary range for this role is $100k-135k. It is important to note that our salary ranges are based on paying competitively for our size, industry, and the market and are one part of the total rewards that we provide. Individual pay rate decisions are based on several factors, including qualifications for the role, experience level, skillset, scope of the role, and internal peer benchmarking.

        The above is a comprehensive, but not exhaustive, description of requirements and expectations that may evolve over time based on business needs. You must be able to complete all physical requirements of the job with or without a reasonable accommodation.

        About Boll & Branch:

        At Boll & Branch, we don’t make bedding like everyone else. We make it better.

        In 2014, our founders, Scott and Missy Tannen, challenged every conventional standard in the textile industry, creating a new supply chain that prioritized thread quality, not thread count. By investing exclusively in 100% organic raw materials from the start, we became the first bedding company ever to be Fair Trade Certified. Today, we keep five commitments at the heart of everything we do. We are:

        • Cultivators of the Highest Quality Threads
        • Pioneers in 100% Organic Cotton
        • Free from Toxins at Every Step
        • 100% Traceable from Farm to Finish
        • Committed to Fair and Ethical Treatment for All

        Boll & Branch has over 150 employees, and we are headquartered in Summit, NJ, with a second office in New York, NY and a dedicated Photo Studio in New Providence, NJ. In 2019, to propel our growth, we raised $100M from L Catterton, a leading consumer goods private equity fund. We are also progressively expanding our retail and wholesale footprint. While the heart of our business lies in the direct-to-consumer online model, we also have three retail stores around the country as well as a partnership with Nordstrom in ~20 locations.

        Boll & Branch LLC is an equal opportunity employer.

        See more jobs at Boll & Branch

        Apply for this job

        +30d

        Senior Backend Engineer (m/f/d)

        Usercentrics GmbHMunich or Remote
        DesignapitypescriptjavascriptbackendfrontendNode.js

        Usercentrics GmbH is hiring a Remote Senior Backend Engineer (m/f/d)

        Location
        Munich or remote
        JOIN OUR #1-RANKED DATA PRIVACY COMPANY
        Usercentrics is a leading and fast growing Consent Management Platform with great ambitions in a very dynamic space of data protection technologies. 

        This is an exciting role as you will have the chance to turn customers, market needs and trends into successful products which will impact millions of users for one of our innovation projects.
        If you are a self-starter and hungry to learn then join our smart, young, highly motivated, hard working, international, and fun team!
        Your Tasks
        • You will be part of our Usercentrics innovation projects that just started - a very start-up/hands-on work-style inside an established company
        • The chance to bring in own ideas, not only on code architecture and best practises, but also ideas that steer the product vision
        • Hands on implementation on the project
        • Ensuring quality of our delivery with sufficient automated testing
        • If a bug is discovered, you are not satisfied with easy solutions, but to identify the root cause and to find sustainable fixes
        You Bring
        • 5+ years of professional frontend development with JavaScript ES6+, TypeScript, Node.js
        • Strong experience in other industry standard libraries for backend services (e.g. Express, NestJS, …)
        • Great knowledge in API design principles
        • Great knowledge of modern JavaScript/TypeScript features, clean code, design principles and functional programming
        • Knowledge in using testing frameworks
        • Experience with Google Cloud Computing or other public cloud providers
        • Excellent written and verbal communication skills in English.
        • A curious, self-driven, product oriented and analytical work style
        Why join Usercentrics?
        • Joining Usercentrics means becoming part of a fast-growing, diverse and international team of tech enthusiasts and entrepreneurially-minded who build our success story together
        • We have offices located in Munich, Copenhagen, Odense and Prague, but you can also join us remotely. Our colleagues are working from Belgium, Canada, Cyprus, The Netherlands, Portugal, The United Kingdom and many more locations
        • Company culture is important to us - we strive to continuously develop a positive, vibrant and inspiring environment that enables everyone to thrive
        • Your work-life balance is important to us too, so we offer flexible working hours and the opportunity to work from other locations (in accordance with our company policy)
        • Get involved! At Usercentrics, every employee has a voice as it is extremely important for us to have everybody represented, and we see it as a huge benefit for both the company and for the people who work here
        • We always remember to have fun along the way, both in our day-to-day work and at our regular team events - or online, to accommodate current restrictions
        • A steep learning curve in a dynamic startup environment with a high career growth opportunity
        About us
        Usercentrics is a global market leader in the field of Consent Management Platforms (CMP).
        We are driven by our company vision to build a world where user privacy enables a thriving digital ecosystem. Our mission is to provide privacy solutions that empower organizations to embrace data privacy while building trust with their users through freedom of choice. With our product, businesses can collect, manage and document user consents on websites and apps, and achieve full compliance in accordance with global privacy regulations while facilitating high consent rates and building trust with their customers.


        Helping clients like Daimler, ING Diba and Santander achieve privacy compliance, Usercentrics is active in more than 100 countries, with 2000+ resellers and handles more than 61 million daily user consents.
        Visit usercentrics.com and cookiebot.com to learn more.
         
         
        Usercentrics provides equal employment opportunities to all employees and applicants for employment and prohibits discrimination and harassment of any type without regard to race, colour, religion, age, sex, national origin, disability status, genetics, protected status, sexual orientation, gender identity or expression. This policy applies to all terms and conditions of employment, including recruiting, hiring, placement, promotion, termination, layoff, recall, transfer, leaves of absence, compensation, and training.
        +30d

        Backend Laravel PHP Web Engineer

        Blue Ocean IdeasTowson, MD Remote
        tailwindlaravelgitmysqltypescriptcsskubernetesbackendfrontendPHP

        Blue Ocean Ideas is hiring a Remote Backend Laravel PHP Web Engineer

        We're looking for someone with very strong back-end skills who is an expert in Laravel. You will be working on a recently launched large association management platform built from the ground up with modern techniques in Laravel.

        About You

        You're a strong problem solver who loves to learn — we're not experts in everything and we don't expect you to be either.

        You are passionate about building great software. Quality is very important to you. You understand the value of testing: unit tests, integration tests, performance tests, etc.

        We don't care if you went to school, we just care about what you can do and how you do it. We're all just makers and tinkerers, so as long as you love to build awesome stuff you'll fit right in.

        What you’ll need

        • Strong experience building complex applications with Laravel.
        • Experience writing tests and using PHPUnit.
        • Strong experience with Git and working with a team using code version control.
        • You've worked on large-scale web applications.
        • Knowledge of React is a plus.

        Our Technology Stack

        • Backend
          • PHP
          • Laravel
          • MySQL
          • Redis
          • Algolia
          • Pusher
        • Frontend
          • React / Intertia.js / TypeScript
          • Tailwind CSS
          • Blade
        • Devops:
          • Octane
          • Kubernetes
          • FluxCD

        About Us

        Blue Ocean Ideas solves problems with Truth, Goodness, and Beauty. We’re building the next generation of Association Management Software. We look for team members exhibiting our virtues, core competencies, and role competencies in their domain.

        Our Virtues

        • Wisdom – Knowing how to act in any situation
        • Fortitude – Showing strength and courage
        • Temperance – Exhibiting moderation
        • Justice – Treating everyone equitably
        • Faith – Believing in the best of people and situations
        • Hope – Seeing a bright future and moving toward that future
        • Love – Acting for the benefit of others

        Our Core Competencies

        • Simplify: Things should be made as simple as possible, but no simpler
        • Organize: Things are in order consistently
        • Anticipate: Sees the future and adjusts accordingly
        • Communicate: Clear, forthright, open, honest

        Benefits

        • 401k
        • Flexible time off policy
        • Health insurance (HSA with compatible plans)
        • Dental insurance
        • Vision insurance
        • Life insurance
        • Long-term disability insurance
        • Apple MacBook Pro + second screen

        See more jobs at Blue Ocean Ideas

        Apply for this job

        +30d

        Software Engineer, Backend (USA ONLY, REMOTE)

        FoodaRemote
        agilerubypostgresqlcsskubernetesbackendfrontend

        Fooda is hiring a Remote Software Engineer, Backend (USA ONLY, REMOTE)

        Software Engineer, Backend (USA ONLY, REMOTE) - Fooda - Career Page

        See more jobs at Fooda

        Apply for this job

        +30d

        Node JS Developer

        BuzzBoardRemote
        3 years of experiencemongodbapijavaangularfrontendNode.js

        BuzzBoard is hiring a Remote Node JS Developer

        Node JS Developer - BuzzBoard - Career Page

        See more jobs at BuzzBoard

        Apply for this job

        +30d

        Senior Backend Engineer

        nosqlDesignUI/UX designmongodbc++dockerpythonjavascriptbackendNode.js

        Botkeeper Inc is hiring a Remote Senior Backend Engineer

        Senior Backend Engineer - Botkeeper Inc - Career Page

        See more jobs at Botkeeper Inc

        Apply for this job

        +30d

        Backend Engineer

        nosqlDesignUI/UX designmongodbc++dockerpythonjavascriptbackendNode.js

        Botkeeper Inc is hiring a Remote Backend Engineer

        Backend Engineer - Botkeeper Inc - Career Page

        See more jobs at Botkeeper Inc

        Apply for this job