elasticsearch Remote Jobs

109 Results

1d

Data Analyst / Analytics Engineer (H/F)

CleverConnectParis, France, Remote
agilesqlc++elasticsearchpython

CleverConnect is hiring a Remote Data Analyst / Analytics Engineer (H/F)

Description du poste

En tant que Data Analyst, quelles seront vos responsabilités ????‍????????‍?????

  • Collaborer avec les départements Product, Sales, Marketing et Communication pour comprendre les besoins métier et les traduire en solutions de données.

  • Implémenter et optimiser des modèles de données à l'aide de DBT et garantir la qualité et l'intégrité des données. Vous serez en charge de transformer et mettre en forme les données du datawarehouse en approche ELT.

  • Utiliser BigQuery et DBT pour analyser de grands ensembles de données et en tirer des insights exploitables.

  • Créer et maintenir des rapports et des tableaux de bord dans des outils de dataviz type Looker Studio, Superset, PowerBI ou Metabase. Ces tableaux de bords peuvent concerner les besoins internes (product, communication, marketing, sales, etc.) et externes (embedded dans nos solutions à destination des clients).

  • Participer à la conception des pipelines d’ingestion de données avec le Data Engineer.

  • Effectuer des analyses ad hoc et fournir des recommandations basées sur les données pour soutenir les décisions métier.

 

Qualifications

Qui êtes-vous ?

Vous avez au moins 5 années d'expérience en tant que Data Analyst dans un environnement similaire. 

Techniquement et idéalement ????????,

  • Maîtrise avancée de SQL et expérience de travail avec des ensembles de données à grande échelle.

  • Expérience pratique avec BigQuery, DBT ou équivalents requis. Expériences Snowplow et Elasticsearch appréciées.

  • Familiarité avec les outils de visualisation de données tels que Looker Studio, Superset, PowerBI ou Metabase.

  • Être à l’aise dans le scripting python pour automatiser certaines transformations de données.

  • Avoir déjà manipulé un outil de Web Analytics tel que Google Analytics.

  • Expérience dans un environnement Agile et capacité à travailler en collaboration dans des équipes interfonctionnelles.

Que trouverez-vous chez CleverConnect ?

  • Une équipe dirigeante accessible, bienveillante et à l’écoute 
  • Des bureaux au cœur des villes et la possibilité de faire du télétravail ????

  • Des opportunités de formation, d’évolution et de mobilité en Europe 

  • RTT, mutuelle, carte déjeuner, remboursement 50% transport, forfait mobilité durable

Notre processus de recrutement comprend:

  • Entretien initial avec un Responsable de l'Acquisition de Talents

  • Entretien avec le Manager (découverte/évaluations techniques) 

  • Dernier entretien avec le Directeur IT ou CPTO.

See more jobs at CleverConnect

Apply for this job

1d

AWS/Node.js Developer (Remote Opportunity)

VetsEZCharlotte, NC Remote
agileBachelor's degreenosqlDesignmongodbapigitjavadockerelasticsearchlinuxjenkinspythonAWSbackendNode.js

VetsEZ is hiring a Remote AWS/Node.js Developer (Remote Opportunity)

VetsEZ is seeking an AWS/Node.js Engineer Subject Matter Expert (SME) to be a part of a remote team. This candidate should have experience in cloud-based technologies specifically with developing and re-engineering middle-ware applications and solutions that leverage the AWS Cloud services.

The candidate must reside within the continental US.

Responsibilities:

  • Provide subject matter expertise to an agile team on a range of AWS cloud service implementation, migration, delivery, and performance management activities for multiple AWS environments.
  • Participate in technical research and development to enable continuing innovation within the infrastructure.
  • Design and build middleware solutions to enable the integration of different systems and applications.
  • Work closely with team members as needed to resolve technical issues, as well as perform routine tasks such as monitoring, server management, user and group administration, software installation, imaging etc.
  • Maintain and improve existing middleware solutions; Optimize performance, scale out and build resiliency in the platform.
  • Working as both an infrastructure and application development specialist.
  • Play a key role in migrating and transforming legacy solutions to cloud native architecture and in advising and implementing AWS best practices.
  • Work with team to enhance the automation capabilities of deployment, monitoring, & maintenance, within the DevSecOps construct.
  • Communicate technical concepts to a non-technical audience.

Requirements:

  • Bachelor's degree in Computer Science, Engineering, Management Information Systems, or equivalent degree.
  • 5+ years of demonstrated technical, IT, or Operations experience within a large-scale technology services environment in the following areas: Software Development, Application Support, and Infrastructure Support.
  • Working experience in AWS platform services such as Amazon Lambda, Auto Scaling, Elastic Load Balancing, Amazon Elastic Container Services are required.
  • Strong programming skills, including experience with languages such as node.js, Java and Python (Backend API and Microservices development experience).
  • Experience with AWS Application Migrations with Java based applications or Mainframe applications.
  • Experience in AWS developer tools, SDK, CLI tools, VPC, EC2, EBS, S3, ELB, Auto scaling, Elastic Beanstalk, IAM, RDS, Route 53, Cloud Front, Cloud watch, Cloud Trail, Secrets Manager.
  • Working knowledge of provisioning S3, Lambda, Step functions, API Gateway, SQS, SNS, configuring IAM, RDS, and DynamoDB services.
  • Experience with AWS EC2 Instances provisioning, AWS VPC setup, AWS Auto Scaling for availability of EC2 Instances and availability of applications.
  • Extensive knowledge in creating AWS CloudFormation templates/scripts; Build and Deployment strategies with CloudFormation and Serverless JS Framework.
  • Solid understanding in noSQL database like MongoDB, Elasticsearch, DynamoDB etc.
  • Knowledge on various components like Docker Engine, Hub, Machine, Compose and Docker Registry.
  • Expertise in source control and deployment tools like CodePipeline, GIT, Jenkins, etc.
  • Proficiency in programming with different Java IDE's like Eclipse ,Net beans, Visual Studio
  • Experience with monitoring and metrics (PagerDuty, Dynatrace, CloudWatch, etc.).
  • Understanding of Agile, DevOps and Infrastructure as Code (IaC) is strongly desired and experience working in a DevOps environment with teams.
  • Experience with Red hat Linux, Unix or Windows operating systems.

Additional Qualifications:

  • Experience working with Department of Veterans Affairs (VA) or other health-related organizations desired.

  • AWS Certification a plus.

  • Experience in SAFe/Agile Software Development.

  • Ability to work effectively in a multi-stakeholder and DevSecOps environment.

  • Ability to obtain a government clearance.

Benefits:

  • Medical/Dental/Vision
  • 401k with Employer Match
  • Corporate Laptop
  • PTO + Federal Holidays
  • Training opportunities
  • Remote work options

Qualified applicants will receive consideration for employment without regard to race, color, religion, sex, national origin, sexual orientation, gender identity, disability, or protected veteran status.

Sorry, we are unable to offer sponsorship at this time.

See more jobs at VetsEZ

Apply for this job

2d

Senior Full-Stack Developer (Node.js + React + Go)

Sigma SoftwareSão Paulo, Brazil, Remote
terraformnosqlsqlDesigndockerelasticsearchpostgresqlmysqlkuberneteslinuxjenkinsAWSreactjsNode.js

Sigma Software is hiring a Remote Senior Full-Stack Developer (Node.js + React + Go)

Job Description

  • Design and implement large-scale software solutions and components using multiple technologies (Node.js, ReactJS, and Go are the main ones) 
  • Be a great communicator to be able to actively collaborate and get context for complex tasks 
  • Follow best engineering practices and company/client guidelines 
  • Play supervisory, advisory, and coaching role for less-senior engineers in the team 
  • Be an active contributor to all team-related meetings, events, and ceremonies 
  • Contribute to creating architectural and technical documentation 
  • Promote clean code and design patterns/principles 
  • Actively and permanently work on self-development and self-education, making lessons learned for further advancement to the Principal position

Qualifications

  • 5+ years of software development experience  
  • Strong experience with Node.js and ReactJS 
  • Experienced in Go 
  • Solid experience with SQL and NoSQL databases such as MySQL, PostgreSQL, Redis, Aerospike, and Cassandra 
  • Strong experience in the Linux command line environment 
  • Familiarity with AWS and Terraform 
  • Experience with CI/CD pipelines such as Jenkins, GitHub, GitLab 
  • Experience with Docker and Kubernetes 
  • Familiarity with Spark, Hadoop, and Zookeeper 
  • Understanding of the business and ability to translate business expectations into technical descriptions 
  • Ability to manage time and priorities  
  • Strong feeling of ownership and responsibility 
  • At least an Upper-Intermediate level of English 

 
WOULD BE A PLUS

  • Experience with Kafka, Kibana, Elasticsearch 
  • Familiarity with OpenRTB 
  • Experience in AdTech domain (DSP/SSP/Ad exchange/Bidders) 

See more jobs at Sigma Software

Apply for this job

2d

Staff Cloud Infrastructure Engineer

HandshakeRemote (USA)
agileterraformDesignc++elasticsearchkubernetesAWSbackend

Handshake is hiring a Remote Staff Cloud Infrastructure Engineer

Everyone is welcome at Handshake. We know diverse teams build better products and we are committed to creating an inclusive culture built on a foundation of respect for all individuals. We strongly encourage candidates from non-traditional backgrounds, historically marginalized or underrepresented groups to apply.

Your impact

At Handshake, we are assembling a team of dynamic engineers who are passionate about building high-quality, impactful, self-service platforms. As a Staff Cloud Infrastructure Engineer, you will spearhead the management of our Infrastructure as Code and Kubernetes platforms, guaranteeing their seamless operation in a scalable cloud environment. Your expertise will be pivotal in optimizing our platforms for maximum efficiency and reliability, owning our Technical Excellence and SRE programs, ensuring they meet the demands of our growing business while maintaining robust scalability. You'll play a crucial role in mentoring and developing junior engineers, fostering a collaborative and growth-oriented team culture.

Your role

  • Design, implement, and maintain scalable cloud infrastructure solutions using industry best practices.

  • Collaborate with cross-functional teams to ensure smooth integration of infrastructure components and broader application architecture.

  • Monitor, analyze, and optimize cloud infrastructure performance, reliability, and cost-effectiveness.

  • Automate deployment, configuration, and management tasks using infrastructure as code (IaC) tools such as Terraform and Spacelift.

  • Provide technical guidance and mentorship to junior members of the infrastructure team.

  • Participate in on-call rotations to address infrastructure-related incidents and ensure high availability of our cloud services and the Handshake Platform.

  • Stay updated on emerging cloud technologies and trends, evaluating their potential impact on existing infrastructure and recommending appropriate adoption strategies.

  • Design and document infrastructure configurations, procedures, and best practices to facilitate knowledge sharing and maintain operational efficiency.

  • Lead our Technical Excellence program, increasing observability and measurement of KPIs & SLOs across our platforms.

  • Implement modern, cloud-native solutions such as service mesh, advanced scaling and deployment strategies, workflow orchestration.

  • Develop and improve processes to provide self-service and first-class user experience for our engineers.

  • Be a thought leader, drive innovation by helping to develop team roadmaps aligning with our business goals.

  • Work in a 100% Cloud Environment (GCP) and use tools and services like Argo Workflows, Argo CD, Datadog, Kubernetes, improving the reliability and scalability of our platforms.

Your experience

  • You are adept with agile software development lifecycle and DevOps principles

  • You thrive taking projects from inception to completion and are outcome-oriented, measuring business impact

  • You act with empathy when partnering with fellow engineers and coworkers, focusing on user experience and simplicity

  • You build and maintaining cloud-based architectures in AWS and/or GCP, at scale

  • You have expertise with Kubernetes, IaC, observability and modern infrastructure tooling

  • You have prior experience with building and maintaining self-service tooling and guardrails

  • You have experience in securing Cloud workloads through implementing best practices such as OPA, RBAC, and utilizing Kubernetes security features

  • You have experience building or working directly with SRE in areas related to Operational Readiness and Incident Response

  • You have Infrastructure networking experience: firewalls, load balancing, DNS, etc.

  • You are passionate about building simple, yet high-quality infrastructure

  • You have experience working in distributed, performant, at-scale backend systems

  • You are strong in Operations and have a passion for automation and reducing toil

Bonus areas of expertise

  • GitOps & Argo ecosystem of tools

  • Service Mesh (istio, Linkerd, etc.)

  • ElasticSearch and search indexing, semantic and vector search experience

  • Distributed tracing and observability with tools like Datadog, OTEL

  • FinOps and cloud cost controls/governance

Compensation range

$210,000-$240,000

For cash compensation, we set standard ranges for all U.S.-based roles based on function, level, and geographic location, benchmarked against similar stage growth companies. In order to be compliant with local legislation, as well as to provide greater transparency to candidates, we share salary ranges on all job postings regardless of desired hiring location. Final offer amounts are determined by multiple factors, including geographic location as well as candidate experience and expertise, and may vary from the amounts listed above.

About us

Handshake is the #1 place to launch a career with no connections, experience, or luck required. The platform connects up-and-coming talent with 750,000+ employers - from Fortune 500 companies like Google, Nike, and Target to thousands of public school districts, healthcare systems, and nonprofits. In 2022 we announced our $200M Series F funding round. This Series F fundraise and valuation of $3.5B will fuel Handshake’s next phase of growth and propel our mission to help more people start, restart, and jumpstart their careers.

When it comes to our workforce strategy, we’ve thought deeply about how work-life should look here at Handshake. With our Hub-Based Remote Working strategy, employees can enjoy the flexibility of remote work, whilst ensuring collaboration and team experiences in a shared space remains possible. Handshake is headquartered in San Francisco with offices in Denver, New York, London, and Berlin and teammates working globally. 

Check out our careers site to find a hub near you!

What we offer

At Handshake, we'll give you the tools to feel healthy, happy and secure.

Benefits below apply to employees in full-time positions.

  • ???? Equity and ownership in a fast-growing company.
  • ???? 16 Weeks of paid parental leave for birth giving parents & 10 weeks of paid parental leave for non-birth giving parents.
  • ???? Comprehensive medical, dental, and vision policies including LGTBQ+ Coverage. We also provide resources for Mental Health Assistance, Employee Assistance Programs and counseling support.
  • ???? Handshake offers $500/£360 home office stipend for you to spend during your first 3 months to create a productive and comfortable workspace at home.
  • ???? Generous learning & development opportunities and an annual $2,000/£1,500/€1,850 stipend for you to grow your skills and career.
  • ???? Financial coaching through Origin to help you through your financial journey.
  • ???? Monthly internet stipend and a brand new MacBook to allow you to do your best work.
  • ???? Monthly commuter stipend for you to expense your travel to the office (for office-based employees).
  • ???? Free lunch provided twice a week across all offices.
  • ???? Referral bonus to reward you when you bring great talent to Handshake.

(US-specific benefits, in addition to the first section)

  • ???? 401k Match: Handshake offers a dollar-for-dollar match on 1% of deferred salary, up to a maximum of $1,200 per year.
  • ???? All full-time US-based Handshakers are eligible for our flexible time off policy to get out and see the world. In addition, we offer 8 standardized holidays, and 2 additional days of flexible holiday time off. Lastly, we have a Winter #ShakeBreak, a one-week period of Collective Time Off.
  • ???? Lactation support: Handshake partners with Milk Stork to provide a comprehensive 100% employer-sponsored lactation support to traveling parents and guardians.

(UK-specific benefits, in addition to the first section) 

  • ???? Pension Scheme: Handshake will provide you with a workplace pension, where you will make contributions based on 5% of your salary. Handshake will pay the equivalent of 3% towards your pension plan, subject to qualifying earnings limits.
  • ???? Up to 25 days of vacation to encourage people to reset, recharge, and refresh, in addition to 8 bank holidays throughout the year.
  • ???? Regular offsites each year to bring the team together + opportunity to travel to our HQ in San Francisco.
  • ????️ Discounts across various high street retailers, cinemas and other social activities exclusively for Handshake UK employees.

(Germany-specific benefits, in addition to the first section)

  • ???? 25 days of annual leave + we have a Winter #ShakeBreak, a one-week period of Collective Time Off across the company.
  • ???? Regular offsites each year to bring the team together + opportunity to travel to our HQ in San Francisco once a year.
  • ???? Urban sports club membership offering access to a diverse network of fitness and wellness facilities.
  • ????️ Discounts across various high street retailers, cinemas and other social activities exclusively for Handshake Germany employees.

For roles based in Romania: Please ask your recruiter about region specific benefits.

Looking for more? Explore our mission, values and comprehensive US benefits at joinhandshake.com/careers.

Handshake is committed to providing reasonable accommodations in our recruitment processes for candidates with disabilities, sincerely held religious beliefs or other reasons protected by applicable laws. If you need assistance or reasonable accommodation, please reach out to us at people-hr@joinhandshake.com.

See more jobs at Handshake

Apply for this job

2d

Lead Backend Engineer: .NET core (C#)

Shift TechnologyFrance - Remote
4 years of experiencesqlc++.netelasticsearchpythonbackend

Shift Technology is hiring a Remote Lead Backend Engineer: .NET core (C#)

The future of insurance starts with AI. To date, Shift Technology's AI-powered products have benefitted more than 300 million policyholders globally by reducing underwriting risk, identifying more fraud, and automating critical tasks throughout the claims process.  Shift harnesses the power of AI to enable the world’s leading insurance organizations to make better decisions. Our products help insurers improve operational efficiency, reduce costs, and deliver superior customer experiences to their policyholders.  Our culture is built on innovation, trust, and a drive to transform the insurance industry by imagining and innovating solutions that impact insurers and their customers - like you! We come from more than 50 different countries and cultures and together we are creating the future of insurance.

About the Engineering Team: 

Our Engineering team lies at the core of the value we offer to our customers. We solve complex problems by working not only within our squads, but also by working collaboratively with other teams across the organization. 

Our tech stack includes Python, Net core (C#), MS SQL Server, Elastic Search, and more. If you are excited by solving complex technical challenges, this is the right place for you!

We are in a process of moving towards distributed data on cloud platforms and have challenging opportunities in optimizing both bulk and real-time processing!

Realtime Services Squad

What you’ll do

  • Write effective, scalable code to help with development of back-end components to improve responsiveness and overall performance.
  • Integrating user-facing elements into applications
  • Deliver, maintain, support and improve new & existing features in our customer products
  • Contribute to Shift’s new technologies adoption by monitoring technological development, driving research and building POCs
  • Provide technical guidance to peer engineers and help them to upskill

What you bring...

  • You have at least 4 years of experience in software development.
  • You have strong Coding Skills: C# .Net Tech Agnostic comfortable with OOP
  • You master some data streaming tools like Kafka, Spark, Flink, Beam…
  • You have a good understanding of distributed data systems
  • Familiar with Python Frameworks (like Django, Flask or Pyramid)
  • Build and modify high-performance APIs and program
  • Bonus: SQL Server and Elasticsearch in the data layer
  • Create high-availability, low-latency, and high-performance applications
  • Knowledge and understanding of AI/ML Fundamentals
  • You often come up with new ideas to solve complex problems
  • You are used to work closely with cross-functional teams includingProduct, data scientists or engineers
  • You can communicate fluently in English.

 Recruitment Process

  • HR Screening
  • Technical Screening with a senior back-end engineer
  • Second Technical screening with a technical lead
  • Final Round with Hiring Manager 

#LI-BA1 #LI-ONSITE  #LI-HYBRID

 

To support our permanent, full time employees at every stage of their careers and lives, we provide a competitive total rewards and benefits package. Here are the global benefits we’d like to highlight:

  • Flexible remote and hybrid working options
  • Competitive Salary and a variable component tied to personal and company performance
  • Company equity
  • Focus Fridays, a half-day each month to focus on learning and personal growth
  • Generous PTO and paid holidays
  • Mental health benefits 
  • 2 MAD Days per year (Make A Difference Days for paid volunteering)

Additional benefits may be offered by country - ask your recruiter for more information. Intern and Apprentice position are eligible for some of these benefits - ask your recruiter for more details.

At Shift we strive to be a diverse and inclusive workforce. We hire and trust people without regard to race, color, religion, marital status, age, national or ethnic origin, physical or mental disability, medical condition, pregnancy, genetic information, gender identity or expression, sexual orientation, or other non-merit criteria.

Shift Technology is committed to providing reasonable accommodations for qualified individuals with disabilities in our application and employment process. Should you require accommodation, please email accommodation@shift-technology.com and we will work with you to meet your accessibility needs.

Shift Technology does not accept unsolicited CVs from recruiters or employment agencies in response to the Shift Technology Careers page or a Shift Technology social media post. Any unsolicited CVs, including those submitted directly to hiring managers, are deemed to be the property of Shift Technology.

See more jobs at Shift Technology

Apply for this job

3d

Software Engineer, Data

JW PlayerUnited States - Remote
agileairflowjavadockerelasticsearchkubernetespythonAWSbackend

JW Player is hiring a Remote Software Engineer, Data

About JWP:

JWP is transforming the Digital Video Economy as a trusted partner for over 40,000 broadcasters, publishers, and video-driven brands through our cutting-edge video software and data insights platform. JWP empowers customers with unprecedented independence and control over their digital video content. Established in 2004 as an open-source video player, JWP has evolved into the premier force driving digital video for businesses worldwide. With a rich legacy of pioneering video technology, JWP customers currently generate 8 billion video impressions/month and 5 billion minutes of videos watched/month. At JWP, everyone shares a passion for revolutionizing the digital video landscape. If you are ready to be a part of a dynamic and collaborative team then join us in shaping the future of video! 

The Data Engineering Team: 

At JWP, our data team is a dynamic and innovative team, managing the data lifecycle, from ingestion to processing and analysis, touching every corner of our thriving business ecosystem. Engineers on the team play a pivotal role in shaping the company's direction by making key decisions about our infrastructure, technology stack, and implementation strategies. 

The Opportunity: 

We are looking to bring on a Software Engineer to join our Data Engineering team. As an Engineer on the team, you will be diving into the forefront of cutting-edge big data tools and technology. In this role, you will have the opportunity to partner closely with various teams to tackle crucial challenges for one of the world's largest and rapidly expanding video companies. Join us and make an impact at the forefront of digital innovation.

As a Data Engineer, you will:

  • Contribute to the development of distributed batch and real-time data infrastructure.
  • Mentor and work closely with junior engineers on the team. 
  • Perform code reviews with peers. 
  • Lead small to medium sized projects, documenting and ticket writing the projects. 
  • Collaborate closely with Product Managers, Analysts, and cross-functional teams to gather insights and drive innovation in data products. 

Requirements for the role:

  • Minimum 3+ years of backend engineering experience with a passionate interest for big data.
  • Expertise with Python or Java and SQL. 
  • Familiarity with Kafka
  • Experience with a range of datastores, from relational to key-value to document
  • Demonstrate humility, empathy, and a collaborative spirit that fuels team success. 

Bonus Points:

  • Data engineering experience, specifically with data modeling, warehousing and building ETL pipelines
  • Familiarity with AWS - in particular, EC2, S3, RDS, and EMR
  • Familiarity with Snowflake
  • Familiarity with Elasticsearch
  • Familiarity with data processing tools like Hadoop, Spark, Kafka, and Flink
  • Experience with Docker, Kubernetes, and application monitoring tools
  • Experience and/or training with agile methodologies
  • Familiarity with Airflow for task and dependency management

Perks of being at JWP, United States

Our goal is to take care of you and ensure you will be successful in your new role. Your success is our success! 

As a full time employee, you will qualify for:

  • Private Medical, Vision and Dental Coverage for you and your family
  • Unlimited Paid Time Off
  • Stock Options Purchase Program
  • Quarterly and Annual Team Events
  • Professional Career Development Program and Career Development Progression
  • New Employee Home Office Setup Stipend
  • Monthly Connectivity Stipend
  • Free and discounted perks through JWP's benefit partners
  • Bi-Annual Hack Weeks for those who are interested in using their coding knowledge
  • Fireside chats with individuals throughout JWP

*Benefits are subject to location and can change at the discretion of the Company. 

Check out our social channels:

    

We are an equal opportunity employer and value diversity at our company. We do not discriminate on the basis of race, religion, color, national origin, gender, sexual orientation, age, marital status, veteran status, or disability status.

See more jobs at JW Player

Apply for this job

4d

Senior Software Engineer (Server) - Inventory

SquareAtlanta, GA, Remote
Designelasticsearchmysql

Square is hiring a Remote Senior Software Engineer (Server) - Inventory

Job Description

At Square’s Inventory Foundations team, we're on a mission to revolutionize how businesses manage inventory, making it seamless for sellers worldwide to keep track of their products and make strategic, informed decisions. Together, we'll build systems that support our community of sellers and developers, creating a positive impact on businesses worldwide.

What Makes This Role Unique?

  • Impact: Your work directly influences the success and efficiency of countless businesses, ensuring they have the tools to thrive in any market condition.

  • Deliver Excellence: Architect and develop systems that are both powerful and user-friendly, ensuring our community thrives

  • Collaboration: Join a vibrant, inclusive team where product, design, and engineering experts come together to create holistic solutions. Your voice matters in every technical decision, shaping the future of our products and technology.

What You'll Do:

  • Empower Growth: Architect and develop scalable, reliable platforms that anticipate the future needs of our diverse merchants.

  • Lead with Vision: Guide architectural discussions, championing performance, fault tolerance, and maintainability. Your ideas will pave the way for innovative solutions.

  • Mentor and Inspire: Share your knowledge and passion for engineering excellence, helping to elevate the team's technical prowess and problem-solving capabilities.

  • Innovate Fearlessly: Design systems robust enough to allow for rapid iteration and bold experimentation, without compromising customer experience.

Who Thrives Here:

  • Individuals passionate about making a tangible impact on the business landscape.

  • Curious minds eager to explore new technologies and approaches to solving complex problems.

  • Collaborative spirits who excel in a dynamic, team-oriented environment.

  • Innovators who are not afraid to challenge the status quo and drive technological advancement.

Join Us: If you're ready to build the future of inventory management and make a lasting impact, we can't wait to hear from you. Let's create something extraordinary together.

Qualifications

You have:

  • 6+ years of industry experience, preferably with a B.S. or equivalent.

  • Experience building and maintaining highly scalable and performant distributed systems

  • Technical initiative and a desire to make those around you better

  • Experience with incident response, including disaster recovery

  • Eagerness to share your own ideas, and openness to those of others.

  • Experience implementing Data Storage services at scale with one or more of the following databases: MySQL, TiDB, DynamoDB, Amazon RDS, Elasticsearch

  • A knack for creating readable, well-crafted, maintainable code.

Technologies we use and teach:

  • Golang

  • Elasticsearch

  • Protocol Buffers, gRPC

  • MySQL

See more jobs at Square

Apply for this job

4d

Senior Software Engineer, Cash Commerce

SquareNew York, NY, Remote
Bachelor's degreekotlintableauDesignmobilejavaelasticsearchmysqlAWSbackendfrontend

Square is hiring a Remote Senior Software Engineer, Cash Commerce

Job Description

The Cash Commerce team is building ways for customers to take their money further. As part of the Cash Commerce team, Afterpay is transforming the way we pay by allowing customers to buy products immediately and pay for their purchases over four installments. Started as a checkout solution on merchant websites, we now have our own app which millions of customers use regularly. Not only do we offer easy access to in-network merchants from our mobile app, we also have app exclusive merchants and gift cards that customers can shop right from our app.

We are embarking on a new 0 to 1 initiative to help our merchants find value based on their user data.This is a rare opportunity to become a founding member of a complex and transformative, multi-year initiative in its nascent stage. 

We are looking for energetic engineers who are willing to take a complex problem, break it down into smaller parts and run with it. Successful engineers on this team are eager to take principled risks, get motivated by challenges and have a bias toward delivering value to our customers.  

As a Senior engineer on the Cash Commerce team, you will:

  • Contribute to the ideation, strategy, design, implementation of 0 to 1 products and infrastructure
  • Partner with full stack development team (engineers, designers, PMs, data scientists, business operations) to ship innovative and incredible experiences at scale
  • Collaborate with multiple teams at Block distributed across different time zones
  • Help structure our team’s processes and operational excellence
  • Lead and participate in critical technical, design, and product discussions 

Qualifications

You have: 

  • 6+ years of software development or equivalent experience
  • Ability to work on both Frontend and Backend
  • Strong analytical and problem-solving abilities to identify and resolve issues related to data quality, system performance, and integration challenges
  • Experience designing, developing, and consuming RESTful APIs
  • Experience working with data science and web teams
  • Ability to contribute to an ambiguous 0 to 1 project
  • Exceptional written and verbal technical communication skills
  • Bachelor's Degree or Diploma in Computer Science, or equivalent experience

Highly Preferred:

  • Experience in ad-tech, setting up campaigns, integration with ad managers 
  • Proficiency in data visualization tools such as Tableau
  • Technologies we use and teach:

Technologies we use and teach:

  • Java, Kotlin
  • MySQL, Dynamo, ElasticSearch
  • gRPC and Protocol Buffers
  • Amazon Web Services (AWS)
  • DataDog, Prometheus

See more jobs at Square

Apply for this job

4d

Principal Software Engineer, Cash Commerce

SquareNew York, NY, Remote
Bachelor's degreekotlinDesignmobilejavaelasticsearchmysqlAWSbackend

Square is hiring a Remote Principal Software Engineer, Cash Commerce

Job Description

The Cash Commerce team is building ways for customers to take their money further. As part of the Cash Commerce team, Afterpay is transforming the way we pay by allowing customers to buy products immediately and pay for their purchases over four installments. Started as a checkout solution on merchant websites, we now have our own app which millions of customers use regularly. Not only do we offer easy access to in-network merchants from our mobile app, we also have app exclusive merchants and gift cards that customers can shop right from our app.

We are embarking on a new 0 to 1 initiative to help our merchants find value based on their user data.This is a rare opportunity to become a founding member of a complex and transformative, multi-year initiative in its nascent stage. 

We are looking for an engineering leader who is willing to take a complex problem, break it down into smaller parts and run with it. Successful engineers on this team are eager to take principled risks, get motivated by challenges and have a bias toward delivering value to our customers. 

As a Principal engineer on the Cash Commerce team, you will:

  • Lead the ideation, strategy, design, implementation of 0 to 1 products and infrastructure
  • Partner closely with a full stack development team (engineers, designers, PMs, data scientists, business operations) to ship innovative and incredible experiences at scale
  • Collaborate with multiple teams at Block distributed across different time zones
  • Help structure our team’s processes and operational excellence
  • Lead and participate in critical technical, design, and product discussions 

Qualifications

You have:

  • 10+ years of software development or equivalent experience
  • An analytical mindset with the ability to distill and communicate complex user data to make eng design decisions and determine roadmap prioritization
  • Experience in building partner integrations
  • Experience working with data science and privacy/risk team
  • Ability to translate complex data sets into actionable insights for stakeholders
  • Experience building backend systems with high availability, scalability, and reliability
  • Proven collaboration skills to lead a project across multiple teams
  • Ability to mentor junior engineers
  • Exceptional written and verbal technical communication skills
  • Bachelor's Degree or Diploma in Computer Science, or equivalent experience

Highly preferred:

  • Experience in user data platform, advertising, and identity. (Eg. worked in user identity space for marketing/targeting or integration with DSPs, Ad-managers) 

Technologies we use and teach:

  • Java, Kotlin
  • MySQL, Dynamo, ElasticSearch
  • gRPC and Protocol Buffers
  • Amazon Web Services (AWS)
  • DataDog, Prometheus

See more jobs at Square

Apply for this job

4d

Backend Engineer, Data Stores: Global Search

GitLabRemote
rubyelasticsearchpostgresqlkubernetesbackendfrontend

GitLab is hiring a Remote Backend Engineer, Data Stores: Global Search

The GitLab DevSecOps platform empowers 100,000+ organizations to deliver software faster and more efficiently. We are one of the world’s largest all-remote companies with 2,000+ team members and values that foster a culture where people embrace the belief that everyone can contribute. Learn more about Life at GitLab.

An overview of this role

TheGlobal Search team is focused on bringing world-class search experience to GitLab SaaS and self-managed customers. We empower our users with advanced text and code searches. We are exploring bringing in the latest AI technologies to provide an even better search experience and results. In this role, you will use Ruby on Rails, GoLang, search engines like Elasticsearch and Zoekt, PostgreSQL, and AI technologies to develop GitLab’s core search functionalities. At the same time, you will also be advising other development teams on best practices for leveraging Global Search capabilities (e.g. indexing and searching various product feature contents).


Some examples of our projects: 

What You’ll Do  

  • Building best-in-class search experience for GitLab customers and users
  • Improve and implement our indexing and searching strategies
  • Own architecture, performance, and scaling of the GitLab search solutions with Elasticsearch and other search engines.
  • Build responsive and scalable services and APIs
  • Self-managed installation mechanisms

What You’ll Bring 

  • Strong professional work experience in Ruby and Ruby on Rails.
  • Proficient in Golang or willing to learn on the job.
  • Elasticsearch or other search engine experience - modeling, processing, nodes, index management, and performance tuning.
  • Experience with Retrieval-Augmented Generation and Vector databases is preferred
  • Understand Database principles and optimization mechanisms, especially PostgreSQL.
  • Understand system internals, distributed systems, and high availability principles.
  • Experience with Kubernetes and Helm is preferred.
  • Proficiency in the English language, both written and verbal.
  • Self-motivated and self-managing, with strong organizational skills.
  • Share a set of GitLab values and work in accordance with those values.
  • Experience working with a remote team or ability to thrive in a fully remote organization.
  • Passionate about/experienced with open source and developer tools.
  • Work experience in product companies.

About the team

Global Search team is a group of backend and frontend engineers who are passionate about adopting the latest search technologies to help GitLab users find the information they need. The team members are distributed across the globe but they share the GitLab Values. Please take a look at our team page and our roadmaps to learn more about the team.

How GitLab will support you

Please note that we welcome interest from candidates with varying levels of experience; many successful candidates do not meet every single requirement. Additionally, studies have shown that people from underrepresented groups are less likely to apply to a job unless they meet every single qualification. If you're excited about this role, please apply and allow our recruiters to assess your application.


Country Hiring Guidelines:GitLab hires new team members in countries around the world. All of our roles are remote, however some roles may carry specific location-based eligibility requirements. Our Talent Acquisition team can help answer any questions about location after starting the recruiting process.  

Privacy Policy:Please review our Recruitment Privacy Policy. Your privacy is important to us.

GitLab is proud to be an equal opportunity workplace and is an affirmative action employer. GitLab’s policies and practices relating to recruitment, employment, career development and advancement, promotion, and retirement are based solely on merit, regardless of race, color, religion, ancestry, sex (including pregnancy, lactation, sexual orientation, gender identity, or gender expression), national origin, age, citizenship, marital status, mental or physical disability, genetic information (including family medical history), discharge status from the military, protected veteran status (which includes disabled veterans, recently separated veterans, active duty wartime or campaign badge veterans, and Armed Forces service medal veterans), or any other basis protected by law. GitLab will not tolerate discrimination or harassment based on any of these characteristics. See also GitLab’s EEO Policy and EEO is the Law. If you have a disability or special need that requires accommodation, please let us know during the recruiting process.

See more jobs at GitLab

Apply for this job

5d

Senior DevSecOps Engineer

MuteSixSan Antonio, TX, Remote
agileterraformDesignansiblegitrubyjavac++elasticsearchtypescriptkubernetespythonAWS

MuteSix is hiring a Remote Senior DevSecOps Engineer

Job Description

Isobar Public Sector is seeking a Senior DevSecOps Engineer. Successful candidates should have senior knowledge and hands-on experience building and maintaining CI/CD pipelines for a large enterprise with a strong "security first" mindset. In this role you will be responsible for planning and leading major technology assignments.

Isobar works with the Air Force and DoD on some of the most advanced projects in the world today. Our work has real-world impacts, such as facilitating the evacuation of civilians from Afghanistan in the largest single-day military evacuation of civilians in history. Join our team and practice state-of-the-art DevSecOps development on projects that MATTER. Learn the latest technologies and processes and apply them with military-grade cybersecurity.

What You’ll Do

  • Function as a technical expert across the team; planning and leading major technology assignments.
  • Build and maintain CI/CD pipelines for a large enterprise that consists of hundreds of applications.
  • Develop, test, and maintain containerized applications with a “security first” mindset.
  • Create and maintain documentation for implementations.
  • Learn new technologies and gain expert-level understanding of the latest approaches (auto-scaled cloud-based systems, serverless architectures, cloud/on-premises hybrid solutions).

Who You Are

  • A US Citizen and possess an active TS Security Clearance with SCI eligibility.
  • Reside in the San Antonio, TX area. Initial training at Lackland AFB with periodic on-site work thereafter.
  • Advanced understanding in agile and DevSecOps methodologies.
  • 5+ years of experiencewith:
    • Git
    • AWS Console and CLI
    • DevOps
    • Application containers
  • 3+ years of experience with:
    • IaaS/PaaS
    • Platform Engineering
    • Kubernetes
    • GitOps
    • IaC/CaC CI/CD Pipelines
    • Automated testing
    • Modern programming Languages such as: Java,
    • C#, Python, Ruby, TypeScript, or Go
    • YAML
  • General Knowledge of how to use the following technologies to further development of a Platform:
    • DoD DevSecOps Reference Architecture
    • Terraform, Ansible, Helm, Kustomize, and Flux
    • GitLab
    • Big Bang (Istio, Elasticsearch, Logstash, Kibana,
    • Prometheus, Kyverno, etc.)
    • Custom Helm Charts, Resource Definitions,
    • Controllers, Operators
    • SOPS
    • DoDPKI, x.509, OIDC, SAML, SSO
    • RKE2
  • B.S. in Computer Science or Engineering field and 7+ years of experience contributing on a technical team for a software or IT project.
  • Must be certified in one or more of the following: CISSP, CASP+CE or CSSLP or able to obtain within 30 days.
  • Certified Kubernetes Administrator (CKA) or Certified Kubernetes Application Developer (CKAD) certification is strongly preferred.
  • Experience working with Platform One Big Bang is strongly preferred.

Who We Are

We are trusted digital navigators delivering customer-centric solutions to the US Government, Public Sector, and Educational Institutions. We utilize human-centered design, emerging technology, and data-driven transformation to formulate digital solutions to deliver on our client’s modernization goals and improve mission performance.

We put our people first, above all else. We lead authentically and believe investing in our people is the key to our success. In doing so, we enable purposeful collaboration with our people, stakeholders, and clients, successfully striving for dynamic growth and intentional progress.

Here are some of the benefits that accompany full-time employment at Isobar:

  • We offer flexible time off for vacation and personal time. We believe in treating adults like adults and allowing for open communication between team members and their supervisors to determine proper timing and coverage.
  • In addition to 16 recognized holidays, our offices are closed the last week in December. This adds up to 21 paid company holidays.
  • Multiple levels of offerings for medical and dental, including a covered membership fee to exceptional primary care through One Medical.
  • Other miscellaneous benefits like Short-Term and Long-Term Disability at no cost, company-covered Life Insurance at double your base salary, access to group legal services, identify theft protection through LifeLock services, etc.
  • A generously paid parental leave policy that enables 16 weeks of leave, regardless of gender, at 100% pay.
  • Supporting employees pursuing adoption or surrogacy, Isobar will reimburse up to $14,440 in eligible adoption expenses and $25,000 in eligible surrogacy expenses. 
  • 401K + company matching: 50% of every dollar you contribute, up to the first 6% you contribute; you are 33% vested after each year of service, becoming fully vested after three years with the company.

The anticipated salary range for this position is $160,000-$180,000. Salary is based on a range of factors that include relevant experience, knowledge, skills, and other job-related qualifications. For more information regarding dentsu benefits, please visit: dentsubenefitsplus.com

#LI-YC1

 

Qualifications

Apply for this job

9d

Analista de Desenvolvimento de Software Java Sênior

ExperianSão Paulo, Brazil, Remote
scalanosqlpostgresDesignmongodbscrumgitjavadockerelasticsearchmysqljenkinsAWS

Experian is hiring a Remote Analista de Desenvolvimento de Software Java Sênior

Job Description

Área:Marketing Services Development
Subárea:Targeting/EDQ

Como será o seu dia a dia?

  •  Irá atuar em uma squad, participando efetivamente de cerimonias, discussões, apoio nas tomadas de decisões e resolução de conflitos;
  • Irá atuar na co-criação de novas soluções em conjunto com nosso time de produtos;
  • Será responsável por assegurar a qualidade e segurança do software entregue;
  • Comunicar o design de uma forma que os outros membros da equipe compreendam;
  • Integrar o sistema com os novos componentes de software produzidos ou alterados.

Quais serão suas principais entregas?

  • Desenvolver softwares para atendimento das necessidades internas;
  • Atuar na manutenção de soluções existentes e propor melhorias nas mesmas;
  • Participar de discussões técnicas para criar softwares de alta qualidade e alto desempenho;
  • Ajudar na concepção e arquitetura das aplicações de software;
  • Implementar as melhores práticas técnicas com qualidade e segurança;
  • Realizar testes unitários, teste funcionais e automação de testes das soluções desenvolvidas;
  • Seguir as orientações da arquitetura de referência;
  • Promover boas práticas e aprendizado contínuo;
  • Documentar os projetos de software;
  • Reutilização de componentes.

Qualifications

O que estamos buscando em você!

  • Experiência e conhecimentos avançados em Java;
  • Experiência na arquitetura de micro-serviços;
  • Experiência na Stack Spring (Spring Framework 4.0+, SpringBoot, Spring Data, etc);
  • Experiência com bancos de dados relacionais (Postgres e MySQL);
  • Experiência com soluções e recursos AWS;
  • Experiência com Maven;
  • Experiência em controle de versionamento com Git;
  • Experiência com filas;
  • Experiência com CI/CD (Jenkins);
  • Conhecimento de testes automatizados;
  • Conhecimento em Veracode;
  • Conhecimento/Experiência com frameworks ágeis (Scrum, Kanban, Lean);
  • Familiaridade com containerização (Docker, Kubbernets);
  • Familiaridade com monitoramento (Grafana, Kibana);
  • Familiaridade com desenvolvimento responsivo;
  • Boa comunicação escrita e verbal;
  • Pessoa antenada às novidades da área, curiosa e responsável.

Desejável conhecimento em:

  • Ferramentas/soluções para Marketing;
  • Bancos de dados NOSQL (MongoDB e Elasticsearch);
  • Spark e/ou Scala 2;
  • Hadoop (HDFS, MapReduce, Spark, Hive, Hbase);

See more jobs at Experian

Apply for this job

9d

Staff Software Engineer - Ruby, Consumer Services (remote)

ExperianNew York, New York, Remote
agileBachelor's degreeDesignelasticsearchmysql

Experian is hiring a Remote Staff Software Engineer - Ruby, Consumer Services (remote)

Job Description

*This is a remote role, however Experian would prefer candidates located in the Eastern Time Zone, or able/willing to work ET hours.

The Staff Software Engineer will play a key role in the design and development of key initiatives within the Insurance domain in Experian Consumer Services. Insurance is one of the fastest growing areas within Experian and we are looking for a strong Software Engineer who thrives in a fast-moving environment. The candidate will work very closely with product owners, architects, and engineering teams to deliver high quality, scalable, secure cloud-based technology solutions.

Key Responsibilities:

  • Design, Development and Testing of key applications within Insurance Engineering.
  • Development of technical solutions that are built for quality, scale and performance.
  • Collaborate with the business, product management and PMO on product roadmaps and quarterly planning sessions.
  • Participate in code and design reviews to minimize rework and catch issues early in the process.
  • Ensure stable Production operations with focus on uptime, performance, security and reliability.
  • Work efficiently as a part of a global team of engineers ensuring effective collaboration, communication, and delivery.
  • Write secure, clean, and maintainable code, following industry best practices and coding standards.
  • Conduct code reviews, provide constructive feedback, and mentor junior team members.

Qualifications

  • Bachelor's degree in computer science or related field preferred or equivalent amount of experience, knowledge, and skills.
  • Minimum of 5 years of professional experience working with RubyOnRails, building and maintaining scalable secure web applications.
  • Experience with React and Nodejs.
  • Proficiency in database technologies, such as MySQL and experience with data modeling and query optimization.
  • Experience with testing frameworks like RSpec.
  • Strong knowledge of web services and APIs, including RESTful architecture.
  • Deep understanding and hands-on experience with ElasticSearch, including indexing, querying, and performance optimization.
  • Able to work in a fast paced and dynamic environment and achieve results amidst constraints.
  • Deep understanding of best design and software engineering practices, design principles and patterns and unit testing.
  • Ability to mentor junior team members.
  • Ability to take ownership of tasks and drive them to completion.
  • Excellent communication skills and the ability to effectively collaborate with cross functional teams in an Agile development environment.

See more jobs at Experian

Apply for this job

10d

Senior Site Reliability Engineer - (GS)

ITScoutLATAM, AR Remote
terraformDesignmobilerubyjavaelasticsearchpython

ITScout is hiring a Remote Senior Site Reliability Engineer - (GS)

⚠️Only available for #residents of #Latinamerica⚠️


Our client builds smart technology solutions through the combination of artificial intelligence, mobile, and web development for companies in the United States, Canada & Latam. It´s a technology company headquartered in Costa Rica. With operations throughout LATAM. Their core focus is building intelligent tech solutions to help our customers be more efficient in optimizing internal digital processes.

About the job Senior Site Reliability Engineer

Join our team as a Senior Site Reliability Engineer and become an integral part of our core & observability team, responsible for ensuring the operational efficiency of our cloud platforms and services.

Responsibilities:

  • Hands-on production of software for our products.
  • Establishing design patterns and frameworks for service reliability.
  • Collaborating with teams to instrument system, application, and business KPIs.
  • Defining processes for hosting and deploying live services.
  • Conducting code reviews and driving continuous improvement processes.

Qualifications:

  • Solid understanding of networking systems and protocols.
  • Experience with managing large-scale web operations in a public cloud environment.
  • Proficiency in programming languages such as Ruby, Go, Java, Python, or equivalent.
  • Familiarity with monitoring and observability tools like Prometheus, Grafana, Elasticsearch, Logstash, Kibana.
  • Experience with infrastructure-as-code technologies (e.g., cloudformation, terraform).

**English: B2+ proficiency required.

See more jobs at ITScout

Apply for this job

10d

Kubernetes - SME 1009WFH - 1523

Global InfoTek, Inc.San Antonio, TX Remote
Bachelor's degreeterraformDesignansibleazuredockerelasticsearchkuberneteslinuxAWS

Global InfoTek, Inc. is hiring a Remote Kubernetes - SME 1009WFH - 1523

Clearance Level: Must be eligible for a secret clearance

US Citizenship: Required
Job Classification: Full Time
Location: Remote

Years of Experience: 3-5 years
Education Level: Bachelor's Degree

Position Description:The K8s Senior will work with the Infrastructure as Code and Site Reliability Engineer SMEs to design, build, and update platform capabilities using Kubernetes native services adhering to Cloud Native Computing Foundation (CNCF) principles, industry best practices, along with the DoD CIO DevSecOps Reference Design, and a loosely coupled microservices-based architecture.

Required Skills:

  • 3 years experience with packaging and securing applications as containers working in Kubernetes
  • IASAE Level II certification (CASP+ CE, CISSP, CISSP Associate, or CSSLP)
  • Demonstrated mastery of Kubernetes, Istio, GitOps, Custom Kubernetes Operators, Custom Helm charts, Kustomize, Custom Admission Controllers, Custom CRDs, and Custom Controllers.
  • Demonstrated mastery of Linux and networking.
  • Demonstrated mastery of Kubernetes and containers.
  • Demonstrated mastery of Kubernetes control plane and each component.
  • Demonstrated mastery of Istio.
  • Demonstrated mastery of security and compliance for Kubernetes.
  • Demonstrated mastery of building automation and configuration management tools (e.g. Ansible, Terraform).
  • Demonstrated mastery of cloud and hybrid cloud architecture Amazon AWS, , Microsoft Azure, or Google Cloud Platform (GCP).
  • Demonstrated mastery of common infrastructure tools like Docker, Terraform, and Helm, Git/GitLab/GitOPs, ArgoCD, Flux, Ansible.
  • Demonstrated mastery working with large-scale products with thousands of end-users.
  • Have a software development background.
  • Demonstrated mastery of creating and maintaining documentation for implementations.
  • CKA OR CKAD Certification.

Desired Skills:

  • Experience managing different Kubernetes providers (e.g., RKE2, Amazon EKS and Fargate, Azure KS and Google KE) or run your own.
  • Experience working at scale with other Architects on Security, Data protection, and Failover-Failback strategies.
  • Experience implementing Continuous Integration, Delivery, and Deployment using different CI/CD tools.
  • Experience with Big Bang (Istio, Elasticsearch, Logstash, Kibana, Prometheus, Kyverno, etc.)
  • NIST Risk Management Framework (RMF)

Global InfoTek, Inc. is an equal-opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, protected veteran status, or based on disability.

About Global InfoTek, Inc. Global InfoTek Inc. has an award-winning track record of designing, developing, and deploying best-of-breed technologies that address the nation's pressing cyber and advanced technology needs. For close to three decades, GITI has rapidly combined pioneering technologies, operational effectiveness, and best business practices.


See more jobs at Global InfoTek, Inc.

Apply for this job

12d

Senior Cloud Platform Engineer

SignifydDenver, CO; New York City, NY; United States (Remote);
Bachelor degreeterraformDesignjavaelasticsearchmysqltypescriptkubernetespythonAWSjavascript

Signifyd is hiring a Remote Senior Cloud Platform Engineer

Signifyd is looking to hire a Senior Cloud Platform Engineer responsible for the design, implementation, and management of our cloud-based infrastructure. You will lead a team of highly skilled engineers maintaining and automating a vast cloud-based computing environment supporting Signifyd’s decision platform. The candidate will collaborate with development teams and fellow cloud infrastructure engineers to address critical issues. Proficiency in cloud technologies, containers, Kubernetes, networking, security, scripting, automation, and platform engineering, ensuring seamless system operations. The candidate should possess strong technical aptitude, software development skills, analytical and communication skills, and exceptional problem-solving ability. For this role, we are open to hiring an SE3 or SE4 level.

What You'll Do

  • Collaborate with cross-functional teams to design, build, and maintain highly available, scalable, and secure cloud-based services, promoting efficiency and self-service principles.
  • Develop and maintain automation scripts and tools to streamline infrastructure provisioning, configuration, and deployment, empowering engineering teams.
  • Implement and manage Kubernetes clusters for container orchestration, monitoring, and scaling.
  • Drive an evolution of services to support cloud-native managed services, including an evolution of Kubernetes.
  • Drive efforts to enhance cloud infrastructure security, including access controls, encryption, and vulnerability assessments, focusing on engineering security solutions.
  • Collaborate on CI/CD (TeamCity) pipelines to automate software deployment, including the build platform (Java, Gradle Enterprise) and QA/Testing tooling to drive DevEx up and CFR to zero, emphasizing engineering and self-service automation.
  • Define and maintain cloud engineering best practices and standards to ensure design and implementation consistency.
  • Collaborate with software engineers to optimize applications for cloud deployment, emphasizing performance and scalability.
  • Evaluate emerging cloud and DevOps technologies, providing recommendations for integration into cloud engineering practices.
  • Participate in capacity planning and resource optimization for cost-effective cloud infrastructure usage.
  • Troubleshoot complex engineering issues, provide root cause analysis and propose engineering-focused solutions.
  • Create and maintain comprehensive documentation related to the cloud infrastructure, engineering practices, and security configurations.
  • Mentor and provide technical guidance to junior team members, fostering a culture of excellence.

 

What You'll Need

  • Proficiency in cloud platforms (AWS, GCP) with a focus on engineering best practices.
  • Extensive expertise in Kubernetes (self-managed and cloud-managed flavors, architectures, operations, etc.), cloud infrastructure (AWS and GCP), and ideally databases (at least one of MySQL, Cassandra, DynamoDB, or Elasticsearch)
  • Deep knowledge of best practices for cloud environments, including security, cost optimization, operational excellence, reliability, and performance efficiency.
  • In-depth knowledge of networking principles, protocols, and security best practices for high-performance solutions.
  • Strong understanding of DevOps practices, CI/CD pipelines (TeamCity, GitHub Actions, AWS CodePipeline), and infrastructure-as-code tools (e.g., Terraform, Pulumi).
  • Excellent problem-solving skills, effective in a fast-paced, collaborative environment.
  • Excellent experience in Infrastructure-As-Code (IaC) best practices (Terraform).
  • Experience in software development in general, with skills in a high-level language (e.g., Python, JavaScript, TypeScript, Java) and familiarity with modern development practices
  • Understanding of Cloud Observability, Monitoring, and Tracing tools (Datadog, CloudWatch, Jaeger, ELK) and how best to leverage to support effective MTTR and mitigate high CFR

#LI-Remote
 

Benefits in our US offices:

  • Discretionary Time Off Policy (Unlimited!)
  • 401K Match
  • Stock Options
  • Annual Performance Bonus or Commissions
  • Paid Parental Leave (12 weeks)
  • On-Demand Therapy for all employees & their dependents
  • Dedicated learning budget through Learnerbly
  • Health Insurance
  • Dental Insurance
  • Vision Insurance
  • Flexible Spending Account (FSA)
  • Short Term and Long Term Disability Insurance
  • Life Insurance
  • Company Social Events
  • Signifyd Swag

We also want to provide an inclusive interview experience for all, including people with disabilities. We are happy to provide reasonable accommodations to candidates in need of individualized support during the hiring process.

Signifyd provides a base salary, bonus, equity and benefits to all its employees. Our posted job may span more than one career level, and offered level and salary will be determined by the applicant’s specific experience, knowledge, skills, and abilities, as well as internal equity and alignment with market data.

USA Base Salary Pay Range
$160,000$200,000 USD

See more jobs at Signifyd

Apply for this job

13d

Senior Software Engineer Back

ShippeoParis, France, Remote
agilenosqlpostgresRabbitMQDesignmongodbscrumapisymfonyelasticsearchmysqlbackendfrontendPHP

Shippeo is hiring a Remote Senior Software Engineer Back

Job Description

Our product is composed of a mission critical SaaS web platform (API everywhere), with high traffic inbound/outbound integrations.

Our mission is to anticipate problems and proactively alert end-customers so they can efficiently manage exceptions. We achieve this by collecting and matching millions of theoretical and real data from different stakeholders.

 

The technical team is structured in three feature teams:

  • Connect to collect: quickly build highly-available integrations to fetch and send orders, events and positions (we are looking for someone to join this team in priority)

  • Track to react: automatically track orders, detect exceptions and alerts our users so they can react

  • Analyze to improve: leverage our data to improve our offer insights to our users

In a context of strong growth, we are looking for a Senior Software Engineer PHP / Symfony to deliver cutting edge solutions with a mindset oriented on delivering a production ready solution.

Reporting to the Engineering Manager, your work will focus on improving our technical architecture and developing new functionalities. You will be responsible for all aspects : technical design, development, testing, documentation, deployment and maintainability.

What you will do:

  • Design and maintain server-side application logic using PHP Symfony in an event-driven environment

  • Write qualitative, readable and tested code

  • Collaborate with front-end developers on designing the most performant and scalable APIs

  • Design and optimize applications for high performance, high availability and high scalability

  • Ensuring optimal performances of the requests to the databases

  • Document your processes, your APIs using OpenAPI and the database schemas

  • Apply new architectural patterns within our stack : DDD, CQRS, event sourcing, micro-services

  • Keep informed of advancements in the field of engineering

 

Generally composed of 2 backend developers, 2 frontend developers, 1 product manager, 1 product designer, each feature team has the full ownership for selecting and delivering the features that will have the greatest impact for our users. Close collaboration, agile method and tests: we try every sprint to improve our processes.

Your stack :

  • Stack : PHP (Symfony 6.4) 

  • Event Driven Design philosophy: DDD Main Patterns : CQRS, Event sourcing

  • Asynchronous event model (RabbitMQ)

  • Interface: API REST

  • Testing : Phpspec, Phpunit, Phpstan,

  • Database: Postgres, MySQL,MongoDB,Postgres, Time Series Database, Algolia,

  • EventStoreDB Methodology : OKR, Scrum, Event storming

Qualifications

We are looking for a developer with a good knowledge of the technologies we use, but what matters most is that:

  • You are passionate, experienced and enjoy working in a team in an agile context

  • You are not afraid to confront new problems and overcome them

  • You deliver qualitative, powerful and tested code 

 

Your Profile :

  • Must have experience with a event driven architecture
  • Software Engineering in a highly paced environment

  • Must have experience in developing server-side application logic using PHP Symfony

  • Must have experience with at least one relational database and a noSQL database

  • Familiarity with RabbitMQ, Grafana, Kibana, ElasticSearch

  • You develop pragmatic solutions without overengineering, and choose simple, straightforward solutions over more complex ones

  • You align your work with the company's business objectives and seek to deliver business value

  • You have a strong emphasis on developing solutions that are production ready with a mindset oriented towards you build it, you run it

See more jobs at Shippeo

Apply for this job

14d

Senior Software Engineer II

FlywireUSA Remote, US, Remote
Designmongodbhtml5javaelasticsearchmysqllinuxAWSjavascript

Flywire is hiring a Remote Senior Software Engineer II

Job Description

The Opportunity:

We, at Flywire, are looking for an experienced Sr. Software Engineer II, ideally with a background in FinTech. Your primary responsibility will be to build and maintain the platform that supports the money movement of our industry leading payment engine moving hundreds of millions everyday. 

You will be joining a team in charge of designing new functionalities and improving the current capabilities to improve speed, cost and scalability of our product. Thus, a commitment to collaborative problem solving, pragmatic design, building quality products and to convey the sensation that the product is the responsibility of all the team is essential. You will be responsible for ensuring high quality code in a team defined timeframe. 

  • Write clean, high quality, testable, secure, maintainable and extendable code
  • Solve items such as challenging bugs and production issues within the development environment
  • Work on complex issues where analysis of situations or data requires an in-depth evaluation of variable factors.
  • Exercise judgment in selecting methods, techniques and evaluation criteria for obtaining results
  • Understand scalability and performance status and make improvement for scalability
  • Drive change and improvement in all phases of the development lifecycle
  • Partake in the recruitment process by identifying and exciting great talent
  • Ensure the best possible performance, quality, and responsiveness of the applications
  • Contribute to the product vision by collaborating with Product Managers and stakeholders
  • Drive initiatives to lead projects as well as mentor team members

Qualifications

Here’s What We’re Looking For:

  • 8+ years of experience in Java
  • Experience in designing, developing and supporting scalable, performant and reliable web applications and distributed systems
  • Seasoned in techniques such TDD and BDD
  • Proficient working with continuous integration and delivery (CI/CD)
  • Understanding of relational databases 
  • Strong understanding of object-oriented fundamentals
  • Great understanding of the other disciplines in the cross functional team: QAs, Product and SREs
  • Outstanding verbal and written communication skills and the ability to collaborate with cross functional teams including product and support 
  • Experience in FinTech or the payment industry will be appreciated
  • The ability to deliver high quality code and learn quickly

Technologies We Use:

  • Java 
  • React
  • JavaScript, HTML5, and CSS3 
  • System management: Linux, MySQL, MongoDB, Redis, Sidekiq, AMQP, ElasticSearch,
  • Machine Learning
  • Cloud platform: AWS

See more jobs at Flywire

Apply for this job

15d

Senior Full Stack Software Engineer - Cloud Applications

JitterbitSão Paulo, Brazil, Remote
DesignapijavadockerelasticsearchmysqltypescriptcsskuberneteslinuxangularAWSjavascriptNode.js

Jitterbit is hiring a Remote Senior Full Stack Software Engineer - Cloud Applications

Job Description

Jitterbit is seeking a Senior Full Stack Software Engineer to join our Cloud Applications team. Jitterbit is an iPaaS (Integration as a Service) and API Management platform who has been recognized in the leader quadrant of Gartner for five straight years. Our customers use our iPaaS and APIM platform to solve mission critical business problems. What is our challenge? To make it easy to integrate our customers’ systems. In order to do this, we need to build and create a SaaS offering that is reliable, stable, and scalable for our customers. Do you have the design, architecting, and code-writing capabilities to take on this challenge? And can succeed in a big way?

ABOUT THE TEAM

The engineering team at Jitterbit believes that the quality of our code reflects directly on us as professionals. We are relentless about crafting a product that is innovative and delivers a memorable user experience; an experience that is fast and robust. As a key engineer on our team, you will collaborate with other engineers, product management, and operations. Our culture is fun, fast-paced, performance-oriented, open, and collegial. We are constantly pushing the technology envelope to the edge! We are very distributed and our culture is set up to make all of us very effective working remotely. We believe in hiring talent where it exists.

ABOUT THE JOB

You will be helping us build, design, and architect awesome and new capabilities on our various Cloud Application products. We are looking for a senior full stack engineer. You will be working with Angular, TypeScript, Node.js, CSS3, Nginx, Tomcat, Kafka, Elasticsearch, MySQL, Linux, Docker, and Kubernetes; to name a few of the technologies we use in our Cloud Apps team. You will have full lifecycle responsibilities to create robust, scalable, and distributed systems that operate flawlessly 24x7x365. You will have an opportunity to learn new things. We’re always expanding into new areas, exploring new technologies and pushing the frontier of our platform.This is an exciting opportunity to work in a highly innovative environment with new technologies as we continue to extend our market leading position.

Qualifications

ABOUT YOU

You are an engineer who can turn ideas into extremely reliable and scalable designs. You code in such a way that other engineers find your code easy to comprehend, modify, and build upon. You believe in the power of Integration and APIs to transform how systems are integrated and how applications are built.

You will be successful in this role if you:

  • Enjoy helping and mentoring others around you as you grow and become a successful engineer and developer
  • Have excellent written and verbal communication skills
  • Are capable of working in a distributed team and able to excel in a remote culture
  • Are self-driven and able to work on key initiatives
  • Take pleasure in making things happen and listen to the input from peers
  • Are able to make data driven decisions
  • Are a believer in a best idea strategy regardless of where or who ideas come from

We are looking for:

  • 5-8+ years of experience in building large scale distributed applications.
  • Strong experience building multi-tenant SaaS applications
  • Strong problem-solving, debugging, and analytical skills with great attention to detail
  • Experience with Microservices and Cloud-based architectures/design patterns

Technical Skills and Experience:

  • Excellent JavaScript, CSS and HTML authoring skills.
  • Proficiency with Javascript, TypeScript, Java Node.js, or Go.
  • Familiar with application deployment via Docker and/or Kubernetes.
  • Hands-on experience with AWS services such as DynamoDB, S3, or CloudFront.
  • Bonus: Experience using DataDog APM and logging.
  • Bonus: Experience developing and releasing using CI/CD pipelines, such as GitHub Actions

See more jobs at Jitterbit

Apply for this job

15d

SDET/Test Automation QA Engineer

SonderMindDenver, CO or Remote
agilepostgresscrumapiqagitrubyc++elasticsearchtypescriptangularjenkinsAWSjavascript

SonderMind is hiring a Remote SDET/Test Automation QA Engineer

About SonderMind

At SonderMind, we know that therapy works. SonderMind provides accessible, personalized mental healthcare that produces high-quality outcomes for patients. SonderMind's individualized approach to care starts with using innovative technology to help people not just find a therapist, but find the right, in-network therapist for them, should they choose to use their insurance. From there, SonderMind's clinicians are committed to delivering best-in-class care to all patients by focusing on high-quality clinical outcomes. To enable our clinicians to thrive, SonderMind defines care expectations while providing tools such as clinical note-taking, secure telehealth capabilities, outcome measurement, messaging, and direct booking.

To follow the latest SonderMind news, get to know our clients, and learn about what it’s like to work at SonderMind, you can follow us on InstagramLinkedin, and Twitter

About the Role

As an SDET/Test Automation QA Engineer, you will have a passion for successfully developing robust and scalable testing frameworks to continuously improve quality, reduce cycle time, and bake efficiency into our development and testing processes. You will work closely with Product and Support teams to consistently advocate for end-users by ensuring the SonderMind platform is stable and meets the functional requirements. You strive for quality releases and exceeding customer expectations.    

Essential Functions 

  • Create and maintain automated and manual test cases
  • Assist with any manual testing needs on the team
  • Participate and have input on QA direction discussions; own the QA processes on the team 
  • Accountable for testing all stories coming through the team
  • Work with other SDET’s and Manual testers to ensure cross team projects are thoroughly tested
  • Work closely with engineers  to understand the underlying architecture in the code to create more robust tests.

What does success look like?

  • Quickly integrates into the team and becomes familiar with tools, process, and culture of existing software development and testing life cycles. Tests while leveraging existing scripts and adds to and/or makes recommendations for improvement.
  • Start build and implementation of go-forward test automation framework(s).
  • Well versed in our go-forward automated testing strategy. Fully understands system architecture, business functionality and technical dependencies. The test automation framework is stable, reusable, and positively growing code coverage.

Who you are?

  • 4+ years of software test development experience with proficiency in Javascript, Typescript, or similar 
  • Experience in Unix scripting or equivalent command line tools 
  • Experience with designing and developing full stack test automation ( Protractor, Cypress, etc)  
  • Proficiency with continuous integration and continuous deployment pipelines and tools  (Gitlab CI, CircleCI, Jenkins)
  • Testing and automating RESTful API service calls via tools such as Postman, Bruno, or similar
  • Ability to lead creation and maintenance of advanced suites of automated scripts for the full stack
  • Source control, Git experience
  • Experience in communicating quality reporting and metrics of test execution results, including use in visibility dashboards
  • Strong understanding of SDLC processes specifically agile scrum methodology

Preferred Experience 

  • Test case management systems, including creating integrations with one 
  • Load & Performance Test Engineering
  • Demonstrated experience in designing automation creating modular test scripts for reuse
  • Coding or working familiarity with any of the following technologies: Angular, AWS Deployment , ElasticSearch, Unit testing RSpec, Jasmine or similar experience, Ruby on Rails, Postgres, Redis

Our Benefits 

The anticipated salary rate for this role is between $114,000-130,000 per year.

As a leader in redesigning behavioral health, we are walking the walk with our employee benefits. We want the experience of working at SonderMind to accelerate people’s careers and enrich their lives, so we focus on meeting SonderMinders wherever they are and supporting them in all facets of their life and work.

Our benefits include:

  • A commitment to fostering flexible hybrid work
  • A generous PTO policy 
  • Therapy coverage benefits to ensure our employees have access to the care they need
  • Competitive Medical, Dental, and Vision coverage with plans to meet every need, including HSA and FSA options
  • Employer-paid disability & AD&D to cover life's unexpected events. Not only that, we also cover the difference in salary for up to eight (8) weeks of short-term disability leave
  • Eight weeks of paid Parental Leave  (if the parent also qualifies for STD, this benefit is in addition)
  • 401K retirement plan with 100% matching on up to 4% of base salary

Application Deadline

This position will be an ongoing recruitment process and will be open until filled.

 

Equal Opportunity 
SonderMind does not discriminate in employment opportunities or practices based on race, color, creed, sex, gender, gender identity or expression, pregnancy, childbirth or related medical conditions, religion, veteran and military status, marital status, registered domestic partner status, age, national origin or ancestry, physical or mental disability, medical condition (including genetic information or characteristics), sexual orientation, or any other characteristic protected by applicable federal, state, or local laws.

Apply for this job