linux Remote Jobs

579 Results

20d

Senior Full Stack Software Engineer - Cloud Applications

JitterbitSão Paulo, Brazil, Remote
DesignapijavadockerelasticsearchmysqltypescriptcsskuberneteslinuxangularAWSjavascriptNode.js

Jitterbit is hiring a Remote Senior Full Stack Software Engineer - Cloud Applications

Job Description

Jitterbit is seeking a Senior Full Stack Software Engineer to join our Cloud Applications team. Jitterbit is an iPaaS (Integration as a Service) and API Management platform who has been recognized in the leader quadrant of Gartner for five straight years. Our customers use our iPaaS and APIM platform to solve mission critical business problems. What is our challenge? To make it easy to integrate our customers’ systems. In order to do this, we need to build and create a SaaS offering that is reliable, stable, and scalable for our customers. Do you have the design, architecting, and code-writing capabilities to take on this challenge? And can succeed in a big way?

ABOUT THE TEAM

The engineering team at Jitterbit believes that the quality of our code reflects directly on us as professionals. We are relentless about crafting a product that is innovative and delivers a memorable user experience; an experience that is fast and robust. As a key engineer on our team, you will collaborate with other engineers, product management, and operations. Our culture is fun, fast-paced, performance-oriented, open, and collegial. We are constantly pushing the technology envelope to the edge! We are very distributed and our culture is set up to make all of us very effective working remotely. We believe in hiring talent where it exists.

ABOUT THE JOB

You will be helping us build, design, and architect awesome and new capabilities on our various Cloud Application products. We are looking for a senior full stack engineer. You will be working with Angular, TypeScript, Node.js, CSS3, Nginx, Tomcat, Kafka, Elasticsearch, MySQL, Linux, Docker, and Kubernetes; to name a few of the technologies we use in our Cloud Apps team. You will have full lifecycle responsibilities to create robust, scalable, and distributed systems that operate flawlessly 24x7x365. You will have an opportunity to learn new things. We’re always expanding into new areas, exploring new technologies and pushing the frontier of our platform.This is an exciting opportunity to work in a highly innovative environment with new technologies as we continue to extend our market leading position.

Qualifications

ABOUT YOU

You are an engineer who can turn ideas into extremely reliable and scalable designs. You code in such a way that other engineers find your code easy to comprehend, modify, and build upon. You believe in the power of Integration and APIs to transform how systems are integrated and how applications are built.

You will be successful in this role if you:

  • Enjoy helping and mentoring others around you as you grow and become a successful engineer and developer
  • Have excellent written and verbal communication skills
  • Are capable of working in a distributed team and able to excel in a remote culture
  • Are self-driven and able to work on key initiatives
  • Take pleasure in making things happen and listen to the input from peers
  • Are able to make data driven decisions
  • Are a believer in a best idea strategy regardless of where or who ideas come from

We are looking for:

  • 5-8+ years of experience in building large scale distributed applications.
  • Strong experience building multi-tenant SaaS applications
  • Strong problem-solving, debugging, and analytical skills with great attention to detail
  • Experience with Microservices and Cloud-based architectures/design patterns

Technical Skills and Experience:

  • Excellent JavaScript, CSS and HTML authoring skills.
  • Proficiency with Javascript, TypeScript, Java Node.js, or Go.
  • Familiar with application deployment via Docker and/or Kubernetes.
  • Hands-on experience with AWS services such as DynamoDB, S3, or CloudFront.
  • Bonus: Experience using DataDog APM and logging.
  • Bonus: Experience developing and releasing using CI/CD pipelines, such as GitHub Actions

See more jobs at Jitterbit

Apply for this job

20d

Senior WordPress Developer - Remote

agilejirawordpresslaravelDesignc++linuxAWSPHP

A2 Hosting is hiring a Remote Senior WordPress Developer - Remote

Senior WordPress Developer - Remote - A2 Hosting - Career Page insurances

See more jobs at A2 Hosting

Apply for this job

21d

Devops Engineer

MirantisPoznań, Poland, Remote
Designansibleopenstackdockerkubernetesubuntulinuxpython

Mirantis is hiring a Remote Devops Engineer

Job Description

Job Description

We are looking for a talented DevOps Engineer, who is willing to work on the intersection of IT and software engineering, be passionate about open-source and be able to design and deploy cloud infrastructure built on top of open-source components.

Responsibilities

  • Contribute to and extend observability solutions for Mirantis products 

  • Analyze requirements for the Mirantis products, propose and implement improvements in the monitoring toolset to address use cases

  • Work with geographically distributed international teams on technical challenges and process improvements

  • Contribute to Mirantis knowledge base

  • Continuously improve tooling and technologies set

Qualifications

 

  • Practical administration experience in Linux(RHEL, CentOS, Ubuntu) as a server platform. Required experience with Linux OS itself as well as with production-level software and hardware.

  • Hands-on experience in Ansible, Puppet, or any other IT automation tools

  • Practical administration experience in virtualized environments based on KVM / Docker

  • Hands-on experience in Kubernetes administration

  • Hands-on experience with scripting languages

  • Ability to understand and troubleshoot code written in Python / Golang

  • English language on an Upper-intermediate level+

Will be a plus

  • Knowledge of OpenStack

  • Experience in onboarding applications to the cloud

  • Experience in Python / Golang programming

  • Experience in Prometheus stack

  • Experience in ELK stack

  • Experience in Grafana stack

  • Experience in any other monitoring solutions

See more jobs at Mirantis

Apply for this job

21d

Software Engineer II - Advanced Engineering

Torc RoboticsRemote - US
agileBachelor's degreeDesignc++linux

Torc Robotics is hiring a Remote Software Engineer II - Advanced Engineering

About the Company

At Torc, we have always believed that autonomous vehicle technology will transform how we travel, move freight, and do business.

A leader in autonomous driving since 2007, Torc has spent over a decade commercializing our solutions with experienced partners. Now a part of the Daimler family, we are focused solely on developing software for automated trucks to transform how the world moves freight.

Join us and catapult your career with the company that helped pioneer autonomous technology, and the first AV software company with the vision to partner directly with a truck manufacturer.

 
What you'll do:
  • Responsible for software development, including but not limited to, algorithm development, software design, implementation, unit testing, vehicle testing and deployed software maintenance while following quality, build, deploy and test processes, safety and process requirements and guidelines. 
  • Responsible for executing full software development lifecycle activities using primarily C++ skills in Linux development environment using Lean-Agile methodologies.
  • Responsible to complete software assignments including but not limited to software design, implementation, unit testing, vehicle testing and deployed software maintenance while following quality, build, deploy and test processes, safety and process requirements and guidelines.
  • Assist in root cause analysis of issues found in testing and process automation steps.
  • Support team in identifying daily assignments and reporting progress at daily stand ups.
  • Support software and system level test plans and verification strategies to support ongoing feature development and bug fixes.
  • Designing and implementing systems responsible for data acquisition and analysis from remote vehicles in the field.
  • Responsible for ensuring software updates do not regress the software performance by utilizing simulation software and scenarios.
  • Passion for autonomy technology product area
  • Communicate well in a team environment being able to clearly articulate progress, design expectations and support needed to help the team accomplish goals.
What you’ll need to Succeed:
  • Considered very skilled and proficient in discipline; conducts important work under minimal supervision and with latitude for independent judgment
  • Demonstrates competences and technical proficiencies typically acquired through BS+ 4+ years of experience or MS+ 0-3+ years of experience
Hiring Range for Job Opening 
US Pay Range
$153,200$183,800 USD

At Torc, we’re committed to building a diverse and inclusive workplace. We celebrate the uniqueness of our Torc’rs and do not discriminate based on race, religion, color, national origin, gender (including pregnancy, childbirth, or related medical conditions), sexual orientation, gender identity, gender expression, age, veteran status, or disabilities.

Even if you don’t meet 100% of the qualifications listed for this opportunity, we encourage you to apply. We’re always looking for those that are hungry, humble, and people smart and your unique experience may be a great fit for this role or others.

See more jobs at Torc Robotics

Apply for this job

21d

Senior Infrastructure Engineer (Core)

Telny(Remote) LATAM
terraformDesignansibleapikuberneteslinuxpython

Telny is hiring a Remote Senior Infrastructure Engineer (Core)

About Telnyx

Telnyx is an industry leader that's not just imagining the future of global connectivity—we're building it. From architecting and amplifying the reach of aprivate, global, multi-cloud IP network, to bringinghyperlocal edgetechnology right to your fingertips through intuitive APIs, we're shaping a new era of seamless interconnection between people, devices, and applications.

We're driven by a desire to transform and modernize what's antiquated, automate the manual, and solve real-world problems through innovative connectivity solutions. As a testament to our success, we're proud to stand as a financially stable and profitable company. Our robust profitability allows us not only to invest in pioneering technologies but also to foster an environment of continuous learning and growth for our team.

Our collective vision is a world where borderless connectivity fuels limitless innovation. By joining us, you can be part of laying the foundations for this interconnected future. We're currently seeking passionate individuals who are excited about the opportunity to contribute to an industry-shaping company while growing their own skills and careers.

Are you passionate about building and scaling next-generation infrastructure? Do you thrive in a fast-paced environment where you can make a real impact? If so, then join our rockstar infrastructure team at Telnyx! We're building a cutting-edge, cloud-agnostic platform that spans continents and empowers our product teams to achieve amazing things.

In this role, you'll not only collaborate with a talented team to deploy and maintain our infrastructure provisioning automation, but you'll also have the opportunity to:

  • Shape the future: We value your input! You'll collaborate with engineering teams to identify pain points and continuously improve our internal architecture for scalability and resilience.
  • Become a cloud native expert: Deepen your knowledge of service mesh, container technologies, and CI/CD pipelines.
  • Level up your skills: Learn about every technology stack Telnyx uses and become a well-rounded infrastructure engineer.

You’d Be A Good Fit If You Have

  • 3+ years of professional software development and infrastructure operations experience
  • Strong experience in Kubernetes management and applications development. Better if you have managed on-premises clusters.
  • Proficiency on at least one programming language (Python, Golang, etc). 
  • Expert knowledge of at least one configuration language (Ansible, Puppet, Terraform, etc).
  • Experienced in shaping and improving CI/CD infrastructure design, architecture, and implementation support.
  • General knowledge of container technologies, linux networking and operating systems.
  • Candidates MUST have a good understanding of basic networking protocols like (DNS, HTTP, TLS). Knowing other networking protocols like BGP is a plus.
  • Knowledge of service discovery and service mesh architectures is a big plus.

Growth Opportunities: 

  • Act as a strength multiplier to product engineering efforts. 
  • Learn about every technology stack used at Telnyx.
  • Work at the intersection of the social and the technical, with growth opportunities in both.

Bring Your Authentic Self to Telnyx

Telnyx is committed to building a team full of diverse perspectives, various backgrounds and different minds. We believe diversity drives innovation. We are committed to building a culture where difference is valued and creating avenues of equity for underserved groups. While we are still a work in progress, we are actively seeking folks who are  passionate about building a place of belonging for everyone. 

We're looking for people with passion, grit, and integrity. We believe in transparency, proactivity, and mutual respect. We provide the high-grade tools that help you do your best work, and keep up the collaborative habits that help everyone stay in the loop. No matter where you're based or which team you’re on, you’re plugged in, supported, and helping to shape the future of communications. 

You're encouraged to apply even if your experience doesn't precisely match the job description. Your skills and passion will stand out—and set you apart—especially if your career has taken some extraordinary twists and turns. At Telnyx, we welcome diverse perspectives, rigorous thinkers and assumption challengers. Are you ready to join us?

See more jobs at Telny

Apply for this job

21d

Junior Software Engineer

SuscoRemote
sqlmobileazureuigitrubyjavac++c#.netlinuxangularpythonjavascriptfrontendPHP

Susco is hiring a Remote Junior Software Engineer

Junior Software Engineer - Susco - Career Page

See more jobs at Susco

Apply for this job

21d

Network Advanced Services Engineer (Wireless or Security)

AristaLos Angeles, CA, Remote
Designlinuxpython

Arista is hiring a Remote Network Advanced Services Engineer (Wireless or Security)

Job Description

Arista seeks an Advanced Services Engineer to provide advanced technical, product and solution support, guidance, and assistance to account teams to address specific customer needs. In this position, you will be working as a technology expert in Wi-Fi and networking security to design, implement, and support (troubleshoot) the Campus and Datacenter Networking deployments within a number of customer infrastructures. The ideal candidate will also have a level of comfort communicating across all functions within Arista, as well as with clients and partners.

Considering alternative locations as well: San Diego, CA, Phoenix, AZ or Las Vegas, NV

Essential Functions of the Job:

  • You will provide advanced technical and solution support for Arista's Data Center and Campus networking deployments for our enterprise and commercial customers
  • Translate complex business requirements into the according Network solutions
  • Provide customer advice regarding architectural questions, product prerequisites, product features, etc.
  • Define and review customer architectural network designs and make recommendations for deployment
  • Assist customers in deploying and operating Arista’s Network solutions
  • Migrate or interconnect to/from Cisco, Juniper, Aruba, Palo Alto and other vendors to Arista infrastructure
  • Assist with configuration build-outs including creating network Devop's framework.
  • Drive the proof of concepts (POC) and in-depth testing to validate design scenario
  • Provide bug scrubs and code recommendations
  • Provide interface to TAC and internal development teams and the customer
  • Establish and maintaining strong relationships with key partners
  • Attend key partner events, training sessions, and provide ongoing training with the customer teams globally
  • Maintain professional relationships with teammates, partners, and clients
  • Deep listening skills, customer empathy, humility, and competence are key attributes we seek in a candidate.
  • Some travel may be required within assigned territory

Qualifications

Required Skills and Experience:

  • Bachelor’s degree in Computer Science or equivalent and above
  • Network Industry Certification preferred (e.g. CCIE R&S or CCIE Security)
  • 5+ years of experience working in security or wireless including 2+ years working in a sales or consulting role
  • Demonstrated experience in Network Consulting Engineer or as an Advanced Systems (AS) Engineer preferred
  • Expert knowledge in the networking infrastructure areas: TCP/IP protocol stack, IP Routing, BGP, VxLAN/EVPN, Wi-Fi and Networking Security
  • In-depth knowledges in at least one area of Data Center or Campus related technologies - Native Cloud Computing, Virtualization, Cloud Security and Linux tools
  • Background in Perl, Python, Scripting for creating network automation is highly desired
  • Excellent customer service and verbal communication skills
  • Excellent written and presentation skills and the ability to do related documentation and ticket tracking of opportunities/meeting follow-up

Apply for this job

22d

Senior DevOps/Build Systems Engineer

ProgressHybrid Remote, Sofia, Bulgaria
agileterraformDesignazureUXrubykuberneteslinuxAWS

Progress is hiring a Remote Senior DevOps/Build Systems Engineer

Progress is an experienced, trusted provider of products designed with customers in mind, so they can develop the applications they need, deploy where and how they want and manage it all safely and securely. We take pride in what we do, always valuing the whole person—at work and in life. Our diverse life experiences enrich our culture because people power progress.  

Our platform is the backbone behind billions of people worldwide chatting, flying, presenting, banking, gaming, shopping, and learning. If you're ready to make an impact, our Build and Release Engineering team is looking for talented individuals to join us in India and Ireland. 

What You’ll Do: 

As a vital member of our Build and Release Engineering team, you'll: 

  • Implement and enhance the entire life cycle of services, from design and inception to deployment (on-premise and cloud-based), operations, and refinement.
  • Provide support for services before they go live through system design consulting, software platform development, capacity planning, and launch reviews.
  • Maintain live services by measuring and monitoring availability, latency, and overall system health.
  • Collaborate with internal and external teams on release management activities, including the development of automated deployment and testing tools.
  • Work within an agile team, ensuring proactive communication of status and timely completion of deliverables.
  • Propose and implement continuous improvement activities.
  • Standardize and document common DevOps procedures.
  • Contribute to the development of new features and bug fixes on Progress's custom build services.
  • Practice sustainable incident response and conduct blameless postmortems, guiding ticket resolution for key applications and platforms.
  • Assist the team in diagnosing and correcting build failures.
  • Act as a mentor and learner within a team of world-class engineers.
  • Collaborate with project stakeholders, including product management, UX, other teams, and customers.

Who You Are: 

We're looking for someone with: 

  • Strong experience in software development using Ruby or Python.
  • Familiarity with CI/CD software such as Buildkite or Jenkins.
  • Proactive troubleshooting skills for build failures.
  • Proficiency in bash scripting.
  • Knowledge of Linux system internals.
  • Comfort with cloud-based platforms and tools like Terraform and Docker. Kubernetes experience is a plus.
  • Experience managing AWS or Azure environments.
  • An independent self-starter with a passion for learning through experimentation and research.

We'd be happy to chat if this sounds like you and fits your experience and career goals. What we offer in return is the opportunity to experience a great company culture with wonderful colleagues to learn from and collaborate with and also to enjoy: 

 
Compensation:    
  • Generous remuneration package
  • Employee Stock Purchase Plan Enrollment
Vacation, Family, and Health   
  • 30 days paid annual vacation
  • An extra day off for your birthday
  • 2 additional days off for volunteering
  • Premium healthcare and dental care coverage
  • Additional pension insurance
  • Well-equipped gym on-site
  • Co-funded Multisport card
  • Daycare Center for your little ones onsite
  • Flexible working hours and work-from-home allowance
  • Free underground parking with a designated space for bikes and electric scooters
And most importantly, great company culture with wonderful colleagues to learn from and collaborate with!   
Apply now!   
 
#LI-NT1
#LI-Hybrid   

Together, We Make Progress

Progress is an inclusive workplace where opportunities to succeed are available to everyone. As a multicultural company serving a global community, we encourage a wide range of points of view and celebrate our diverse backgrounds. Our unique combination of perspectives inspires innovation, connects us to our customers and positively affects our communities. It is only by working together and learning from each other that we make Progress. Join us!

See more jobs at Progress

Apply for this job

22d

Senior Website Developer

DaxkoBirmingham, AL, Remote
wordpressDesignUXqamysqlcsslinuxjavascriptfrontendPHP

Daxko is hiring a Remote Senior Website Developer

Job Description

Join our dynamic team as a Senior Website Developer and spearhead the customization and development of our cutting-edge website platform and associated projects. In this pivotal role, you will collaborate closely with our talented UX/UI design team to craft bespoke and semi-custom websites and products. Working in synergy with fellow developers and designers, you'll ensure the seamless completion of projects to meet our clients' unique needs. Furthermore, you'll engage directly with account managers and clients, ensuring timely project development and delivery. If you're passionate about innovation and thrive in a collaborative environment, we want you on our team!

Qualifications

  • Strong teamwork and independent work skills in fast-paced environments, adept at meeting deadlines.
  • Ability to manage multiple projects concurrently and prioritize tasks effectively.
  • Proficiency in clear documentation, both for codes and processes.
  • Commitment to staying updated on industry trends and acquiring new technical skills.
  • Excellent verbal and written communication skills, including client interaction.
  • Exceptional organizational skills, attention to detail, and problem-solving abilities.
  • Proficiency in Microsoft Office Suite or related software.
  • Understanding of digital marketing concepts.
  • Over 4 years of WordPress development experience, including headless setups and SSH/SQL proficiency.
  • Mastery of WordPress hooks, filters, custom post types, and taxonomies, with familiarity in Advanced Custom Fields plugin.
  • Extensive experience in custom theme development and plugin creation.
  • In-depth knowledge of APIs and Gateways.
  • Over 3 years of frontend development experience in JavaScript, HTML, and CSS.
  • Experience in large-scale enterprise builds within fast-paced environments.
  • Capability to execute the full software life-cycle development process, from architecture to maintenance.
  • Completion of a development bootcamp or equivalent coursework.
  • Bachelor’s degree or higher in development, communications, business, or relevant field, or equivalent industry experience.

In your day-to-day, you will:

  • Utilize front-end web development (HTML, CSS, JavaScript) and back-end web development (WordPress, PHP, MySQL) skills to support and complete projects.
  • Use some light server administration to support website hosting of projects (Windows, Linux, Apache).
  • Train and mentor team members on development projects and skills related to development and processes.
  • Utilize project management skills, such as timeline management, resource coordination, and communication, may be required for specific custom website development projects.
  • Participate in regular project ownership of development projects to ensure a supportive lifecycle.
  • Continuous work with UX designer to build custom website solutions on the WordPress platform.
  • Proofread & edit website content as needed or as directed by customers.
  • Update digital media on customers' websites, editing images when necessary.
  • Respond to tickets regarding text & image changes for existing customer websites.
  • Ensure that websites and projects are completed and launched within a set timeframe.
  • Ongoing troubleshooting and resolution of issues/bugs on websites/projects.
  • Collaboration with Customer Success Teams to provide excellent customer service to website and digital marketing customers.
  • QA websites/projects for development issues and best practices from other developers/designers prior to launch.

See more jobs at Daxko

Apply for this job

22d

Senior C++ Application Software Engineer (f/m/div)

Bosch GroupOvar, Portugal, Remote
5 years of experienceDesigngitc++dockerlinuxpython

Bosch Group is hiring a Remote Senior C++ Application Software Engineer (f/m/div)

Job Description

Your contribution to something big: 

    • Design, code and unit-test the software
    • Document the requirements and design
    • Decompose the design into user stories and tasks and estimate using planning poker
    • Translate product/system requirements into component level requirements
    • Plan the order of development in Sprints, focusing on achieving continuous integration
    • Making sure you and your team operate according to Agile/scrum principles
    • Keep abreast of technical developments in own field through study of literature and technical contacts
    • Strong drive for continuous improvement
    • Lead others by example - act as a servant leader
    • Practices lean software development

Qualifications

What distinguishes you:

    • You have a university education in computer or software science at Bachelor level or higher
    • You have at least 5 years of experience in C++
    • You have fluent English language skills (verbal and written)
    • You are able and willing to work at least 2 days per week at the Ovar office
    • You are willing to work in Eindhoven/Netherlands 1-2 weeks per time several times per year
    • You have an understanding of the SOLID-principles and how to apply them in software design
    • You have experience with embedded CPU architectures (ARM microcontrollers, Xilinx Zync)
    • You have experience in using Linux and FreeRTOS
    • You have experience with CM tools like SVN and GIT
    • You have experience in OOAD
    • You have experience using Docker
    • You have experience with wired communication protocols, TCP/IP, RSTP and Ethernet
    • You have specific knowledge of relevant design & modeling methods like e.g. UML
    • You have an understanding of core OS concepts like multi-threading, memory management, power management
    • You have a proactive and eager mindset to get the job done, helping others
    • Being able to decompose complex task and estimate work
    • You can look, realistically, outside the box
    • You have a helicopter view, capable of finding an appropriate solution to complex problems
    • You have a broad interest in Software Development and are familiar with additional programming languages
    • Experience with peripherals such as UART, SPI, i2c/i2s, GPIO, interfacing with FPGA is a plus
    • Experience with Yocto and SCons toolchain is a plus
    • Experience in Python programming language is a plus
    • Experience in C# programming language is a plus
    • Experience in Safety critical systems is a plus

See more jobs at Bosch Group

Apply for this job

Palo Alto Networks is hiring a Remote Principal Consultant, Incident Response - Unit 4

Job Description

Your Career

The role of Consulting Director in Unit 42 is a senior-level consulting position. The individual will be responsible for leading Unit 42's incident response engagements with our largest clients and in our most complex engagements. They will become the go-to expert for clients during high-priority incident response, remediation, and recovery phases, providing both strategic guidance and technical oversight, while also focusing on product integration. The role requires in-depth cybersecurity expertise to enable serving as an incident commander throughout the incident response lifecycle.  

While actively involved in incident response service delivery, this person also works with peers and the executive team to enhance Unit 42’s incident response practice, including developing and improving the technical and operating methodologies employed during incident response engagements. 

We are seeking an individual who is dedicated to delivering highly technical consulting services to an exceptional standard, thrives in a fast paced team environment, and advocates for innovative approaches to deliver the best outcomes for our cross-sector clients. 

Your Impact

  • You are an industry - recognized inspiring leader with media and public speaking experience, deeply embedded in information security community
  • Oversee the delivery of high-profile, high-stakes incident response engagements
  • Provide hands-on, expert-level digital forensics and incident response services to clients and deliver findings to CxO and/or Board of Directors
  • Lead scoping and services overview conversations with clients for prospective engagements in area of expertise, presenting with credibility and authority, clearly articulating various approaches and methodologies to audiences ranging from highly technical to executive personnel
  • Partner with the Unit 42 executive team and service line leaders to develop and execute strategy for the Unit 42 Digital Forensics & Incident Response (DFIR) practice
  • Drive innovation in Unit 42’s reactive offerings, by leading the consulting team and collaborating with cross-functional teams to bring new capabilities and services to market that leverage Palo Alto Networks products
  • Advance the maturation of our existing DFIR services
  • Ensure the consistency and quality of our services and highest level of customer service
  • Integrate threat intelligence into our services by deepening the feedback loop with Unit 42 Threat Intelligence team and telemetry
  • Recruit and onboard world class DFIR talent to support our growth goals
  • Support the professional growth and development of our consultants through training and technical enablement
  • Foster and maintain a culture that attracts and retains smart, kind team members dedicated to executing with excellence
  • Identify and execute strategies for service development, enablement, and product adoption
  • Cultivate and maintain relationships with key clientele to increase awareness of Unit 42’s’ capabilities and provide on-demand expertise for client needs
  • Amplify Unit 42s’ presence and credibility in the marketplace through thought leadership, including via speaking engagements, articles, whitepapers, and media exposure
  • Ability to perform travel requirements as needed to meet business demands  

Qualifications

Your Experience

  • 12+ years of hands-on consulting experience in incident response
  • Demonstrated prior experience and success in leading a global scale incident response engagements
  • Experience in managing, leading and motivating consultants at all levels
  • Experience as a senior-level team leader including overseeing other principal, senior, and mid-level analyst/consultant teams
  • Able to split your time across commercial support, client delivery, team leadership, individual mentoring, and technical expertise and skills maintenance activities
  • Strong presentation, communication, and presentation skills with verifiable industry experience communicating at CxO and/or Board of Directors level
  • Expert level of knowledge of applicable laws, compliance regulations, and industry standards as it relates to privacy, security, and compliance 
  • Hands-on experience  using forensics tools such as EnCase, FTK, SleuthKit, Volatility, etc and analysis experience, an operational understanding of major operating systems (Microsoft Windows, Linux, or Mac), network forensics and cloud incident response
  • Client services mindset and top-notch client management skills
  • Experienced-based understanding of clients’ needs and desired outcomes in digital forensics and incident response investigations
  • Public speaking experience, demonstrated writing ability, including technical reports, business communication, and thought leadership pieces
  • Operates with a hands-on approach to service delivery with a bias towards collaboration and teamwork
  • Bachelor’s Degree in Information Security, Computer Science, Digital Forensics, Cyber Security, or equivalent years of professional experience or equivalent relevant experience or equivalent military experience to meet job requirements and expectations
  • Professional industry certifications such as GIAC Certified Forensic Analyst (GCFA), GIAC Incident Handler (GCIH), CISSP, CISM
  • Understanding of cyber risk frameworks or industry standards such NIST CSF and 800-53, ISO 27001/2, PCI, CIS Top 18, CMMC
  • Ideally you will have experience operating across APAC

See more jobs at Palo Alto Networks

Apply for this job

22d

Principal Consultant - Offensive Security, Unit 4

Palo Alto NetworksSingapore, Singapore, Remote
Designmobileazurerubyjavac++linuxpythonAWS

Palo Alto Networks is hiring a Remote Principal Consultant - Offensive Security, Unit 4

Job Description

Your Career

The Principal Consultant on the Offensive Security team is focused on assessing and challenging the security posture across a comprehensive portfolio of clients. The individual will utilize a variety of tools developed and act as a key team member in client engagements. They will be the client’s advocate for cybersecurity best practices and will provide strong recommendations in this domain. 

Your Impact

  • Conducts periodic scans of networks to find and detect vulnerabilities
  • Performs client penetration testing to find any vulnerabilities or weaknesses that might be exploited by a malicious party, using open-source, custom, and commercial testing tools - Red Team experience essential
  • Ability to assist in scoping engagements by clearly articulating various penetration approaches and methodologies to audiences ranging from highly technical to executive personnel
  • Report generation that clearly communicates testing and assessment details, results, and remediation recommendations to clients
  • Develop scripts, tools, and methodologies to automate and streamline internal processes and engagements
  • Conducts IT application testing, cybersecurity tool and systems analysis, system and network administration, and systems engineering support for the sustainment of information technology systems (mobile application testing, penetration testing, application, security, and hardware testing)
  • Conduct threat hunting and/or compromise assessment engagements to identify active or dormant indicators of compromise (IoCs) using Crypsis and Palo Alto Networks’ threat hunting tools (and/or client owned hunting instrumentation where applicable)
  • Assist Leadership in the development of security standards and best practices for the organization and recommend security enhancements as needed
  • Able to conduct cyber risk assessments using frameworks or standards like NIST CSF, ISO 27001/2, PCI, CIS Top 20, CMMC, or other industry measurement tools
  • Conduct cloud penetration testing engagements to assess specific workloads (i.e., AWS, GCP, Azure, containers, or other PaaS and SaaS instances) for vulnerabilities and subsequently attempt to exploit identified weakness after receiving permission from client stakeholders
  • Provide recommendations to clients on specific security measures to monitor and protect sensitive data and systems from infiltration and cyber-attacks including response and recovery of a data security breach
  • Ability to perform travel requirements as needed to meet business demands  

Qualifications

Your Experience

  • 8+ years of professional experience with risk assessment tools, technologies, and methods focused on Information Assurance, Information Systems/Network Security, Infrastructure Design, and Vulnerabilities Assessments - Red Team experience essential
  • Demonstrate a deep understanding of how malicious software works (i.e.-malware, trojans, rootkits, etc.)
  • Ability to modify known and/or craft custom exploits manually without dependence on consumer tools such as Metasploit
  • Strong knowledge of tools and techniques used to conduct network, wireless, and web application penetration testing
  • Familiarity with web application penetration testing and code auditing to find security gaps and vulnerabilities
  • Knowledge and experience in conducting cyber risk assessments using industry standards
  • Experience with penetration testing, administering, and troubleshooting major flavors of Linux, Windows, and major cloud IaaS, PaaS, and SaaS providers (i.e., AWS, GCP, and Azure)
  • Experience with scripting and editing existing code and programming using one or more of the following - Perl, Python, ruby, bash, C/C++, C#, or Java
  • Experience with security assessment tools, including Nessus, OpenVAS, MobSF Metasploit, Burp Suite Pro, Cobalt Strike, Bloodhound, and Empire
  • Knowledge of application, database, and web server design and implementation
  • Knowledge of network vulnerability assessments, web and cloud application security testing, network penetration testing, red teaming, security operations, or 'hunt'
  • Knowledge of open security testing standards and projects, including OWASP & MITRE ATT&CK
  • Ability to read and use the results of mobile code, malicious code, and anti-virus software
  • Knowledge of computer forensic tools, technologies, and methods
  • Assist in the development of internal infrastructure design for research, development, and testing focused on offensive security
  • Identified ability to grow into a valuable contributor to the practice and, specifically
    • have an external presence via public speaking, conferences, and/or publications
    • have credibility, executive presence, and gravitas
    • be able to have a meaningful and rapid delivery contribution
    • have the potential and capacity to understand all aspects of the business and an excellent understanding of PANW products
    • be collaborative and able to build relationships internally, externally, and across all PANW functions, including the sales team
  • Bachelor’s Degree in Information Security, Computer Science, Digital Forensics, Cyber Security, or equivalent years of professional experience to meet job requirements and expectations or equivalent military experience required

See more jobs at Palo Alto Networks

Apply for this job

22d

Software Engineer - Build Infrastructure

Bachelor's degree3 years of experienceterraformDesignansibleazuregitc++dockerkubernetesubuntulinuxpythonAWS

Torc Robotics is hiring a Remote Software Engineer - Build Infrastructure

About the Company

At Torc, we have always believed that autonomous vehicle technology will transform how we travel, move freight, and do business.

A leader in autonomous driving since 2007, Torc has spent over a decade commercializing our solutions with experienced partners. Now a part of the Daimler family, we are focused solely on developing software for automated trucks to transform how the world moves freight.

Join us and catapult your career with the company that helped pioneer autonomous technology, and the first AV software company with the vision to partner directly with a truck manufacturer.

Meet The Team:

We are seeking people who are passionate about making a difference in the world. Torc is growing, and we’re assembling teams of creative, ambitious people who have the tenacity to make the impossible possible. Join us as we make our roads, workplaces, and missions safer for everyone.

Our culture is one of openness and transparency and our work reflects that. Torc’rs are encouraged to bring forward new ideas and initiatives, and no matter what job you are working on, you’ll be able to directly observe how your contribution comes to life in the solutions we create together.

What You’ll Do:

We’re looking for engineering professionals with expert-level skills in software development and automation combined with experience working in the area of developer enablement to bring new ideas, optimizations, and best practices to the entire software organization. As a software engineer focused on tool development and automation, you will work closely with a passionate team of engineers to improve the processes that support the development of high-quality safety-critical software for self-driving vehicles.

  • Scan the landscape of current tools and processes and find ways to enhance our ability to create, test, and deliver high-quality software that supports the autonomous driving system.
  • Design, implement, and maintain scalable software build and delivery solutions, including management of packages, dependencies, and artifacts.
  • Work with cross-functional teams to develop and enforce best practices for software development and quality assurance in compliance with existing standards.
  • Create new tools that benefit the company, emphasizing automation over manual process, integration of systems to enhance business efficiency, and optimizing employee productivity.

What You’ll Need to Succeed:

  • Degree(s) in Engineering, Computer Science, or a related technical field with relevant experience as specified below:
    • MS with 0-3 years of experience OR BS with 4+ years of experience
  • Proficiency in Linux platforms (Ubuntu, Centos).
  • Proficiency in high-level and scripting languages (C++, Python, bash, groovy).
  • Proficiency in version control systems (Git).
  • Continuous integration/Continuous delivery concepts and tools.
  • Strong ideation skills, creativity, and proactive problem solving.
  • Troubleshooting skills (real-time and in-depth analysis)
  • Test automation principles and design.
  • Performance metrics and analysis.

Bonus Points!

  • Build automation and static analysis tools (CMake, Cppcheck, Clang-Tidy)
  • Experience working with cloud infrastructure at scale (AWS, Azure, GCP)
  • Containerization and container orchestration (Docker, Kubernetes)
  • Configuration management, Infrastructure as Code (Ansible, Terraform)

Perks of Being a Full-time Torc’r

Torc cares about our team members and we strive to provide benefits and resources to support their health, work/life balance, and future. Our culture is collaborative, energetic, and team focused. Torc offers:  

  • A competitive compensation package that includes a bonus component and stock options
  • 100% paid medical, dental, and vision premiums for full-time employees  
  • 401K plan with a 6% employer match
  • Flexibility in schedule and generous paid vacation (available immediately after start date)
  • Company-wide holiday office closures
  • AD+D and Life Insurance 
Hiring Range for Job Opening 
US Pay Range
$139,000$166,800 USD

At Torc, we’re committed to building a diverse and inclusive workplace. We celebrate the uniqueness of our Torc’rs and do not discriminate based on race, religion, color, national origin, gender (including pregnancy, childbirth, or related medical conditions), sexual orientation, gender identity, gender expression, age, veteran status, or disabilities.

Even if you don’t meet 100% of the qualifications listed for this opportunity, we encourage you to apply. We’re always looking for those that are hungry, humble, and people smart and your unique experience may be a great fit for this role or others.

See more jobs at Torc Robotics

Apply for this job

22d

Software Engineer - Developer Environments

Torc RoboticsRemote - US; Blacksburg, VA
Bachelor's degreeterraformDesignansibleazuregitc++dockerkubernetesubuntulinuxpythonAWS

Torc Robotics is hiring a Remote Software Engineer - Developer Environments

About the Company

At Torc, we have always believed that autonomous vehicle technology will transform how we travel, move freight, and do business.

A leader in autonomous driving since 2007, Torc has spent over a decade commercializing our solutions with experienced partners. Now a part of the Daimler family, we are focused solely on developing software for automated trucks to transform how the world moves freight.

Join us and catapult your career with the company that helped pioneer autonomous technology, and the first AV software company with the vision to partner directly with a truck manufacturer.

Meet the Team: 

We are seeking people who are passionate about making a difference in the world. Torc is growing, and we’re assembling teams of creative, ambitious people who have the tenacity to make the impossible possible. Join us as we make our roads, workplaces, and missions safer for everyone. 

Our culture is one of openness and transparency and our work reflects that. Torc’rs are encouraged to bring forward new ideas and initiatives, and no matter what job you are working on, you’ll be able to directly observe how your contribution comes to life in the solutions we create together. 

What you'll do: 

We’re looking for engineering professionals skilled in software development and automation combined with experience working in the area of developer enablement to bring new ideas, optimizations, and best practices to the entire software organization.  As a software engineer focused on tool development and automation, you will work closely with a passionate team of engineers to improve the processes that support the development of high-quality safety-critical software for self-driving vehicles. 

  • Scan the landscape of current tools and processes and find ways to enhance our ability to create, test, and deliver high-quality software that supports the autonomous driving system. 
  • Design, implement, and maintain scalable software build and delivery solutions, including management of packages, dependencies, and artifacts. 
  • Work with cross-functional teams to develop and enforce best practices for software development and quality assurance in compliance with existing standards. 
  • Create new tools that benefit the company, emphasizing automation over manual process, integration of systems to enhance business efficiency, and optimizing employee productivity. 

What you’ll need to Succeed: 

  •  Degree(s) in Engineering, Computer Science, or a related technical field with relevant experience as specified below:
    • M.S. with 0-3+ years of experience ORB.S. with 4+ years of experience
  • Proficiency in advanced build systems (Bazel, BuildBarn).
  • Proficiency in Linux platforms (Ubuntu, Centos).
  • Proficiency in high-level and scripting languages (C++, Python, bash, groovy).
  • Proficiency in version control systems (Git).
  • Continuous integration/Continuous delivery concepts and tools.
  • Strong ideation skills, creativity, and proactive problem solving.
  • Troubleshooting skills (real-time and in-depth analysis).
  • Test automation principles and design.
  • Performance metrics and analysis.

Bonus Points! 

  • Proficiency with static analysis tools (Cppcheck, Clang-Tidy).
  • Experience working with cloud infrastructure at scale (AWS, Azure, GCP).  
  • Containerization and container orchestration (Docker, Kubernetes).
  • Configuration management, Infrastructure as Code (Ansible, Terraform).

Perks of Being a Full-time Torc’r

Torc cares about our team members and we strive to provide benefits and resources to support their health, work/life balance, and future. Our culture is collaborative, energetic, and team focused. Torc offers:  

  • A competitive compensation package that includes a bonus component and stock options
  • 100% paid medical, dental, and vision premiums for full-time employees  
  • 401K plan with a 6% employer match
  • Flexibility in schedule and generous paid vacation (available immediately after start date)
  • Company-wide holiday office closures
  • AD+D and Life Insurance 
Hiring Range for Job Opening 
US Pay Range
$139,000$166,800 USD

At Torc, we’re committed to building a diverse and inclusive workplace. We celebrate the uniqueness of our Torc’rs and do not discriminate based on race, religion, color, national origin, gender (including pregnancy, childbirth, or related medical conditions), sexual orientation, gender identity, gender expression, age, veteran status, or disabilities.

Even if you don’t meet 100% of the qualifications listed for this opportunity, we encourage you to apply. We’re always looking for those that are hungry, humble, and people smart and your unique experience may be a great fit for this role or others.

See more jobs at Torc Robotics

Apply for this job

22d

Principal Engineer - Developer & Operational Tools

Torc RoboticsRemote - US
Bachelor's degreeDesignc++linuxpythonAWS

Torc Robotics is hiring a Remote Principal Engineer - Developer & Operational Tools

About the Company

At Torc, we have always believed that autonomous vehicle technology will transform how we travel, move freight, and do business.

A leader in autonomous driving since 2007, Torc has spent over a decade commercializing our solutions with experienced partners. Now a part of the Daimler family, we are focused solely on developing software for automated trucks to transform how the world moves freight.

Join us and catapult your career with the company that helped pioneer autonomous technology, and the first AV software company with the vision to partner directly with a truck manufacturer.

Meet the Team:

Torc is looking for an experienced principal engineer to serve as the architect and pragmatic visionary for systems that power a modern software development and data ecosystem for autonomous vehicle technology. This role will play a pivotal role in the success of the organization and comes with high visibility, responsibility, and technical impact.  This person must have a strong technical foundation in building and delivering high-performance, resilient, and scalable cloud computing solutions and will bring strategic insights, technical acumen, mentorship, and facilitate collaboration across the organization.

What You’ll Do: 

  • Drive and grow the strategic technical vision for the Developer & Operational Tools Division
  • Responsible for foundational services and systems used by engineers and customers to build and support our autonomous trucking platform.
  • Work within Torc’s Principal Community to mature our technical vision and drive technical direction across the organization.
  • Collaborate with stakeholders to understand requirements and design scalable and maintainable software solutions that support the broader CTO organization.
  • Act as a role-model and set the standards of highest-level technical excellence and rigor within the Developer & Operational Tools Division 
  • Provide technical leadership and guidance to engineering teams in the Developer & Operational Tools Division.
  • Participate in design and code reviews, providing constructive feedback to ensure high-quality solutions that adhere to established standards and practices.
  • Mentor and guide division engineers, assisting in their technical growth and fostering a culture of learning and development within the division.
  • Troubleshoot and debug the most critical issues, determining the root causes, implementing appropriate solutions, and setting up safeguards against reoccurrences.
  • Be able to analyze, and mentor others to analyze, system performance to implement necessary optimizations to enhance speed, efficiency, and scalability.
  • Participate in project planning and collaborate with technical product managers on the priorities and customer expectations of the proposed software solutions.
  • Stays up to date with the latest industry trends, technologies, and best practices for potential integration with existing solutions.

What You’ll Need to Succeed:

  • Demonstrate competences and technical proficiencies typically acquired through:
    • BS with 20+ years of experience, MS with 10+ years of experience, OR PHD with 7+ years of experience.
  • Ten-plus years of experience building and maintaining workloads in public cloud environments.
  • Strong technical communication skills, written and verbal, that scale to a diverse workforce
  • Strong problem-solving skills with the ability to analyze and understand complex software system issues and evolving technical challenges.
  • Strong proficiency in Python and a commitment to test-driven development patterns, continuous integration and delivery, and infrastructure as code
  • Working knowledge of C++, Linux, and modern build automation platforms
  • Strong ability to align technical objectives to business values and articulate the associated business value of technical work.
  • Strong time management and organization skills to plan, develop, prioritize effectively, and maintain competing demands simultaneously with frequent interruptions and in fast-paced environment.
  • Ability to facilitate and drive collaborative engagement across technical teams in a large engineering organization in person and virtually.
  • Willing to travel up to 25% to US or EU locations. Ability to obtain a passport and appropriate documents are required.   

Bonus Points:

  • Knowledge of AWS serverless architectures (Lambda, Batch, ECS Fargate, Glue, Athena) is preferred.
  • Familiarity with robotics and advanced driver assistance systems is preferred.
  • Experience developing data warehousing, data lake or data mesh solutions is preferred.
  • Experience scaling software and infrastructure architectures for simulation environments is preferred.

Perks of Being a Full-time Torc’r

Torc cares about our team members and we strive to provide benefits and resources to support their health, work/life balance, and future. Our culture is collaborative, energetic, and team focused. Torc offers:  

  • A competitive compensation package that includes a bonus component and stock options
  • 100% paid medical, dental, and vision premiums for full-time employees  
  • 401K plan with a 6% employer match
  • Flexibility in schedule and generous paid vacation (available immediately after start date)
  • Company-wide holiday office closures
  • AD+D and Life Insurance 
Hiring Range for Job Opening 
US Pay Range
$226,400$271,700 USD

At Torc, we’re committed to building a diverse and inclusive workplace. We celebrate the uniqueness of our Torc’rs and do not discriminate based on race, religion, color, national origin, gender (including pregnancy, childbirth, or related medical conditions), sexual orientation, gender identity, gender expression, age, veteran status, or disabilities.

Even if you don’t meet 100% of the qualifications listed for this opportunity, we encourage you to apply. We’re always looking for those that are hungry, humble, and people smart and your unique experience may be a great fit for this role or others.

See more jobs at Torc Robotics

Apply for this job

23d

Testing Automation Engineer

ImpervaHybrid Remote, Rehovot, Israel
Designqalinuxjenkinspython

Imperva is hiring a Remote Testing Automation Engineer

Imperva is a multi-billion dollar cybersecurity company, that protects the world’s largest organizations from cyber-attacks. We work in a Hybrid Model from home and from the office (Rehovot) and We have been recognized as one of the Best 50 high-tech companies to work for in Israel 2023 by Dun & Bradstreet! Duns10-Imperva       
 
We are looking for a stellar Testing Automation Engineer to join our WAF team.
At Imperva, Test Engineering goes beyond testing, the teams engage in every phase of the software development life cycle, advocate for the customer and have the skills to implement effective test strategies and E2E automation solutions. Test Engineers collaborate with Dev, PM and cross functional teams.
The Automation Engineer will be responsible for all testing aspects of the products including; participating in all phases of the software development lifecycle and perform hands-on activities such as; test plan design/test automation design, development of tests automation.
Ideal candidate must be familiar with test automation processes, QA methodologies and tools, and must have a track record of very high technical competence and individual accomplishments.
Imperva is working on the core of Application Security products, as well as on some of the most advanced security related features and complex technologies.
    
  
  
Requirements:
  • 2+ years of experience in testing automation. 
  • Experience programming in Python – must.
  • Basic Linux and Networking understanding – must.
  • Experience with DevOps tools like: Jenkins, Gitlab pipelines.
  • Experience with Linux scripting and remote execution.
  • Experience in developing test plans, test matrixes and implementation of test automation.
  • Strong analytical, diagnostic and problem-solving skills with ability to work independently.
Key Responsibilities:
  • Maintain CI Automation and release cycles.
  •  Plan, design, develop and execute Python based automated tests for complex features.
  • Promote automation testing best practices.
  • Be able to adopt new technologies for automation, deployment, analysis and infrastructure.
  • Foster close interface with R&D groups, PM , Security and analytics teams.
Legal Notice:

     Imperva is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, national origin, ancestry, pregnancy, age, sexual orientation, gender identity, marital status, protected veteran status, medical condition or disability, or any other characteristic protected by law.
 
       
#LI-OK1   
 

See more jobs at Imperva

Apply for this job

23d

Senior C++ Developer, Data Security

ImpervaHybrid Remote, Tel Aviv, Israel
apic++kuberneteslinux

Imperva is hiring a Remote Senior C++ Developer, Data Security

Imperva is a multi-billion dollar cybersecurity company, that protects the world’s largest organizations from cyber-attacks. We work in a Hybrid Model from home and from the office (Tel Aviv) and We have been recognized as one of the Best 50 high-tech companies to work for in Israel 2023 by Dun & Bradstreet! Duns10-Imperva       
 
We're looking for a Senior C++ Developer  to join our team.     
The team is responsible for developing & testing Data Application Monitoring solutions. As a Software Engineer, you will be part of a team that develops our state-of-the-art product, leading technology and projects end-to-end while maintaining high-quality standards.
You will be involved with high profile projects and gain a unique perspective into Imperva’s Data Security solution.

  
Requirements:
  • 5+ years as a software developer.
  • Strong understanding in C/C++.
  • Strong background in windows internals – a must.
  • Background in windows API and memory usage – Advantage.
  • High technical skills.
  • Strong background in Linux systems – Advantage.
  • Great interpersonal skills.
  • Sc./M.Sc. in Computer Science or equivalent from a known university.
Key Responsibilities:
  • Develop our Agent product that runs on multiple platforms such as Linux, Windows, Kubernetes etc.
  • Lead development features end-to-end.
  • Become an expert at data security components.
Legal Notice:

     Imperva is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, national origin, ancestry, pregnancy, age, sexual orientation, gender identity, marital status, protected veteran status, medical condition or disability, or any other characteristic protected by law.
 
       
#LI-OK1   
 

See more jobs at Imperva

Apply for this job

23d

Contractor

AltisourceBengaluru, India, Remote
javac++.netlinux

Altisource is hiring a Remote Contractor

Job Description

Responsibilities

 

  • Conduct vulnerability assessments for all types of applications, systems and networks.
  • Communicate security vulnerabilities and corrective actions to various internal groups and validate remediation.
  • Performing code reviews to find vulnerabilities and fix errors overlooked in the development phase.
  • Identify security risks in the software development and deployment process.
  • Utilize commercial and open source vulnerability assessment tools.
  • Perform manual verification of vulnerabilities – reduction of false positives.
  • Create assessment reports and present them to management and technology professionals.
  • Develop metrics for tracking and analyzing vulnerability information.
  • Assist in regular penetration testing.
  • Develop and maintain internal tools and task automation using AI
  • Stay current on information security threats.
  • Train security team members on vulnerability management process and tools.

Qualifications

Required Qualifications & Certifications:

  • Bachelor’s degree in Engineering, Computer science or equivalent
  • 6 to 8 years experience.
  • Possess certification/s related to Vulnerability Assessment such as GIAC, CEH.
  • Must possess excellent written and verbal communication skills.
  • Hands-on experience with performing network vulnerability assessments.
  • Hands-on experience with performing Application scans and code reviews of application codes developed in various technologies.
  • Knowledge of OWASP tools and methodologies
  • Competency with network security and information security concepts and technologies.
  • Thorough knowledge of the Windows OS as well as Linux and Unix variants.

Preferred Qualifications:

  • Experience with vulnerability scanning tools (e.g., Qualys, Nessus, Nexpose, Saint)
  • Experience with web application vulnerability scanning tools (e.g., IBM AppScan, HP Webinspect, Accunetix, NTO Spider, Burpsuite Pro)
  • Experience with static analysis tools (e.g., IBM Appscan Source, HP Fortify)
  • Experience with high level programming languages (e.g., Java, C, C++, .NET (C#, VB))
  • Experience presenting to or training technical audiences a plus.
  • A technical writing experience and/or web development tools is a plus.

See more jobs at Altisource

Apply for this job

23d

Desktop Support Engineer I

Bachelor's degreeremote-firstazurec++linux

Feedonomics is hiring a Remote Desktop Support Engineer I

Desktop Support Engineer I - Feedonomics - Career Page

See more jobs at Feedonomics

Apply for this job

24d

IT-Engineer Professional (m/w/d)

Karriere bei Raptus AGLyss, Switzerland, Remote
azurelinux

Karriere bei Raptus AG is hiring a Remote IT-Engineer Professional (m/w/d)

Stellenbeschreibung

Als IT-System Engineer:in unterstützt Du unsere IT Services Abteilung in sämtlichen Bereichen. Wir fokussieren auf nachhaltige Lösungen, welche bei Kunden einen Mehrwert generieren. Dabei bildet die Basis oft eine Microsoft Lösung, welche individuell auf die Anforderungen abgestimmt ist. Selbstverständlich können dabei auch hybride Lösungen im Sinne des Standort (On-premises, Cloud) oder der Infrastruktur (Windows, Linux, Mac) zum Einsatz kommen.

Du bist an vorderster Front bei der Umsetzung von IT Projekten dabei und stellst den reibungslosen Betrieb der Kundeninfrastruktur sicher. Mit Deiner aufgeschlossenen und leidenschaftlichen Persönlichkeit begleitest Du Kunden und unterstützt das Team bei der kontinuierlichen Weiterentwicklung der IT Lösungen. Nebst den technischen Herausforderungen berätst Du unsere Kunden mit Deinem Charme, erstellst individuelle Konzepte und Angebote.

Du kennst Dich sowohl mit Cloud Lösungen von Microsoft (Azure, M365), als auch mit Netzwerken (Cisco, Ubiquiti, Synology, Sophos) Lösungen bestens aus. Dank Deines Wissens, Deiner Leidenschaft für Technologie und Deiner Spitzfindigkeit kannst Du rasch und systematisch die kniffligen Anfragen von Kunden lösen.

Wir sehen uns als Einheit - als Team, in welchem wir die Kunden ins Zentrum stellen und als Mannschaft die optimale Betreuung, Beratung und Begleitung bieten. Haben wir Dein Interesse geweckt und möchtest Du Teil eines jungen, innovativen und leidenschaftlichen Teams werden? Dann bewirb Dich jetzt als zukünftiger Raptor:in.

Qualifikationen

  • Du hast eine abgeschlossene IT-Ausbildung als Systemtechniker:in oder vergleichbares
  • Du hast Erfahrung im Bereich IT-Engineering (Microsoft 365 und idealerweise Azure)
  • Du sprichst nebst Deutsch auch Englisch (in Wort und Schrift)
  • Du verbindest Teamfähigkeit mit Vertrauen, Konfliktbereitschaft, Verpflichtung, Verantwortung 
  • Du hast Spass daran, Neues zu lernen

See more jobs at Karriere bei Raptus AG

Apply for this job