Node.js Remote Jobs

202 Results

+30d

Senior Software Engineer (Hybrid/Remote)

Oasis Africa Consulting LimitedJakande, Lekki, Nigeria, Remote
agileDesignhtml5scrumapiqagittypescriptAWSjavascriptbackendNode.js

Oasis Africa Consulting Limited is hiring a Remote Senior Software Engineer (Hybrid/Remote)

Job Description

 

Desired Abilities- Ability to:

Design, develop, and maintain high-quality, scalable, and secure software solutions using Node.js, TypeScript, and AWS technologies.

Collaborate with cross-functional teams, including product management, UX/UI design, and QA, to gather requirements, define specifications, and ensure the successful delivery of projects.

Architect and implement efficient, maintainable, and modular code in javascript and Typescript, adhering to best practices, coding standards, and established guidelines.

Optimise application performance by identifying bottlenecks, implementing solutions, and conducting regular code reviews.

Leverage AWS services and tools to design and implement cloud-native applications, ensuring optimal performance, security, and cost-effectiveness.

Participate in the entire software development lifecycle, from planning and design to deployment and maintenance, ensuring smooth project execution.

Stay up-to-date with industry trends, emerging technologies, and best practices in software engineering, particularly within the Node.js, TypeScript, and AWS ecosystems.

Troubleshoot, diagnose, and resolve software issues, providing timely and practical solutions to ensure minimal user disruption.

Collaborate with the other engineering team members to ensure smooth CI/CD pipelines, infrastructure management, and monitoring and alerting systems.

 

You could be an ideal match if you possess:

4+ years of professional experience in software development, focusing on web applications and backend services using JavaScript, TypeScript, and Node.js. You will need to have strong proficiency in JavaScript, TypeScript, and Node.js with a deep understanding of core concepts, asynchronous programming, and performance optimisation techniques.

2+ years of experience working with front-end frameworks, preferably Vue.js - and a solid understanding of HTML5, CSS3, and related web technologies - in building user-friendly and responsive web applications.

Familiarity with Agile development methodologies, such as Scrum or Kanban, and experience working in an Agile environment.

Some experience with NestJS, a progressive Node.js framework, and familiarity with its underlying principles, such as dependency injection and modularity, is a plus.

Knowledge of Domain-Driven Design (DDD) concepts and experience implementing DDD principles in software projects is valuable.

Familiarity with AWS services such as EC2, S3, Lambda, API Gateway, RDS, and Load balancers, and experience building scalable and secure cloud-based applications.

Knowledge of RESTful API design principles.

Experience with version control systems, preferably Git, and understanding of best code management and collaboration practices.

Proficiency in writing and maintaining unit, integration, and end-to-end tests using testing frameworks such as Jest, Mocha, or Jasmine.

Good knowledge of software development best practices, including design patterns, code modularity, and maintainability.

Strong problem-solving skills, with the ability to analyse complex issues, develop practical solutions, and adapt to changing requirements.

Excellent communication and collaboration skills, with the ability to work effectively in a team-oriented environment.

Qualifications

 

An engineering degree is not a prerequisite; instead, we highly value relevant experience in software development and a demonstrable portfolio of projects that highlight your skills.

See more jobs at Oasis Africa Consulting Limited

Apply for this job

+30d

Senior Full Stack Software Engineer - Cloud Applications

JitterbitSão Paulo, Brazil, Remote
DesignapijavadockerelasticsearchmysqltypescriptcsskuberneteslinuxangularAWSjavascriptNode.js

Jitterbit is hiring a Remote Senior Full Stack Software Engineer - Cloud Applications

Job Description

Jitterbit is seeking a Senior Full Stack Software Engineer to join our Cloud Applications team. Jitterbit is an iPaaS (Integration as a Service) and API Management platform who has been recognized in the leader quadrant of Gartner for five straight years. Our customers use our iPaaS and APIM platform to solve mission critical business problems. What is our challenge? To make it easy to integrate our customers’ systems. In order to do this, we need to build and create a SaaS offering that is reliable, stable, and scalable for our customers. Do you have the design, architecting, and code-writing capabilities to take on this challenge? And can succeed in a big way?

ABOUT THE TEAM

The engineering team at Jitterbit believes that the quality of our code reflects directly on us as professionals. We are relentless about crafting a product that is innovative and delivers a memorable user experience; an experience that is fast and robust. As a key engineer on our team, you will collaborate with other engineers, product management, and operations. Our culture is fun, fast-paced, performance-oriented, open, and collegial. We are constantly pushing the technology envelope to the edge! We are very distributed and our culture is set up to make all of us very effective working remotely. We believe in hiring talent where it exists.

ABOUT THE JOB

You will be helping us build, design, and architect awesome and new capabilities on our various Cloud Application products. We are looking for a senior full stack engineer. You will be working with Angular, TypeScript, Node.js, CSS3, Nginx, Tomcat, Kafka, Elasticsearch, MySQL, Linux, Docker, and Kubernetes; to name a few of the technologies we use in our Cloud Apps team. You will have full lifecycle responsibilities to create robust, scalable, and distributed systems that operate flawlessly 24x7x365. You will have an opportunity to learn new things. We’re always expanding into new areas, exploring new technologies and pushing the frontier of our platform.This is an exciting opportunity to work in a highly innovative environment with new technologies as we continue to extend our market leading position.

Qualifications

ABOUT YOU

You are an engineer who can turn ideas into extremely reliable and scalable designs. You code in such a way that other engineers find your code easy to comprehend, modify, and build upon. You believe in the power of Integration and APIs to transform how systems are integrated and how applications are built.

You will be successful in this role if you:

  • Enjoy helping and mentoring others around you as you grow and become a successful engineer and developer
  • Have excellent written and verbal communication skills
  • Are capable of working in a distributed team and able to excel in a remote culture
  • Are self-driven and able to work on key initiatives
  • Take pleasure in making things happen and listen to the input from peers
  • Are able to make data driven decisions
  • Are a believer in a best idea strategy regardless of where or who ideas come from

We are looking for:

  • 5-8+ years of experience in building large scale distributed applications.
  • Strong experience building multi-tenant SaaS applications
  • Strong problem-solving, debugging, and analytical skills with great attention to detail
  • Experience with Microservices and Cloud-based architectures/design patterns

Technical Skills and Experience:

  • Excellent JavaScript, CSS and HTML authoring skills.
  • Proficiency with Javascript, TypeScript, Java Node.js, or Go.
  • Familiar with application deployment via Docker and/or Kubernetes.
  • Hands-on experience with AWS services such as DynamoDB, S3, or CloudFront.
  • Bonus: Experience using DataDog APM and logging.
  • Bonus: Experience developing and releasing using CI/CD pipelines, such as GitHub Actions

See more jobs at Jitterbit

Apply for this job

+30d

Software Engineer

ClassyRemote
sqlDesignuic++AWSjavascriptNode.js

Classy is hiring a Remote Software Engineer

Classy, an affiliate of GoFundMe, is a Public Benefit Corporation and giving platform that enables nonprofits to connect supporters with the causes they care about. Classy's platform provides powerful and intuitive fundraising tools to convert and retain donors. Since 2011, Classy has helped nonprofits mobilize and empower the world for good by helping them raise over $7 billion. Classy also hosts the Collaborative conference and the Classy Awards to spotlight the innovative work nonprofits are implementing around the globe. For more information, visitwww.classy.org.

About the role:

We’re hiring a full stack Software Engineer to work on a fast-paced team. Classy Live helps make the world a better place by providing tools that charitable organizations use to hold live fundraising events. We use React and Node.js to provide cloud-hosted tools around live streaming, auctions and payment processing.

What you’ll do:

  • Learn to be a great software engineer
  • Contribute across the the Classy Live product suite, building:
    • livestream / peer-to-peer technology
    • scalable websocket layer
    • conversational SMS interface
  • Write secure public APIs
  • Play a role in driving the adoption of microservices
  • Write performant SQL and optimize existing queries
  • Work as part of a cross-functional Agile/Scrum team
  • Continuously learn and share knowledge with the team
  • Design new features and rearchitect existing ones.
  • Share and learn from failures
  • Give and receive constructive feedback

What you bring (Required):

  • Bachelor’s Degree in Computer Science or a related field, or equivalent work experience
  • Experience with UI, web server, and database technologies in a cloud-based environment
  • Quality mindset
  • Ability to work at all levels of the tech stack
  • Ability to pick up new technologies in a fast paced environment

What would be awesome to have (Preferred):

  • Experience with AWS
  • Experience with code versioning tools (GIT/Bitbucket)
  • Proficiency in Javascript, React.js, Node.js, SQL
  • Ability to clearly communicate complex ideas

Why you’ll love it here: 

  • Market competitive pay.
  • Rich healthcare benefits including employer paid premiums for medical/dental/vision (100% for employee-only plans and 85% for employee + dependent plans) and employer HSA contributions. 
  • 401(k) retirement plan with company matching.
  • Hybrid workplace with fully remote flexibility for many roles.
  • Monetary support for new hire setup, hybrid work & wellbeing, family planning, and commuting expenses.
  • A variety of mental and wellness programs to support employees.   
  • Generous paid parental leave and family planning stipend.
  • Supportive time off policies including vacation, sick/mental health days, volunteer days, company holidays, and a floating holiday.
  • Learning & development and recognition programs.
  • “Gives Back” Program where employees can nominate a fundraiser every week for a donation from the company.
  • Inclusion, diversity, equity, and belonging are vital to our priorities and we continue to evolve our strategy to ensure DEI is embedded in all processes and programs at GoFundMe. Our Diversity, Equity, and Inclusion team is always finding new ways for our company to uphold and represent the experiences of all of the people in our organization.
  • Employee resource groups.
  • Your work has a real purpose and will help change lives on a global scale.
  • You’ll be a part of a fun, supportive team that works hard and celebrates accomplishments together. 
  • We live by our core values: impatient to be great, find a way, earn trust every day, fueled by purpose.
  • We are a certified Great Place to Work, are growing fast and have incredible opportunities ahead!

GoFundMe is proud to be an equal opportunity employer that actively pursues candidates of diverse backgrounds and experiences. We are committed to providing diversity, equity, and inclusion training to all employees, and we do not discriminate on the basis of race, color, religion, ethnicity, nationality or national origin, sex, sexual orientation, gender, gender identity or expression, pregnancy status, marital status, age, medical condition, mental or physical disability, or military or veteran status.

The total annual salary for this full-time position is $95,000 - $130,000 + equity + benefits.  As this is a remote position, the salary range was determined by role, level, and possible location across the US. Individual pay is determined by work location and additional factors including job-related skills, experience, and relevant education or training. Your recruiter can share more about the specific salary range based on your location during the hiring process. If you require a reasonable accommodation to complete a job application or a job interview or to otherwise participate in the hiring process, please contact us at accommodationrequests@gofundme.com.

Global Data Privacy Notice for Job Candidates and Applicants:

Depending on your location, the General Data Protection Regulation (GDPR) or certain US privacy laws may regulate the way we manage the data of job applicants. Our full notice outlining how data will be processed as part of the application procedure for applicable locations is available here. By submitting your application, you are agreeing to our use and processing of your data as required. 

Learn more about GoFundMe:

For recent company news and announcements, visit our Newsroom.

See more jobs at Classy

Apply for this job

+30d

Intermediate Software Developer, Growth Labs (12 month contract)

VidyardRemote, Canada
agileremote-firstDesigngitrubypostgresqlmysqlcssjavascriptNode.js

Vidyard is hiring a Remote Intermediate Software Developer, Growth Labs (12 month contract)

Vidyard is the video platform that's built for business. Sales reps, marketers, and corporate communicators use Vidyard to record and share videos that grab attention and deliver their message in a personal, impactful way. It's the video tool of choice for Microsoft, LinkedIn, and thousands of other companies. We're passionate about elevating our customers, our teammates, our communities, and ourselves.

About the Role

Vidyard is looking for an Intermediate Software Developerto join our Growth Labs team on a 12 month contract!Reporting to the Software Development Team Lead, you will work on a cross-functional collaborative team to improve our top-of-funnel product growth, build acquisition and retention loops, perform optimization experiments, and ultimately provide a more engaging and personalized experience for our customers. As an experienced software developer, you’ll provide technical leadership and guidance as you iterate and experiment with improvements across our products and website. This is a role for someone who loves making an impact—your work will have a direct influence on important and visible business metrics.

This is a 12 month remote contract (with benefits) open to candidates located within Canada.

About the Team

Our Growth Labs team consists of a small group of developers working with Design, Product, and Marketing counterparts to create more engaging experiences for our customers. We work in an agile, metrics-focused way and perform high-impact experiments that tangibly improve our customers’ experience with our products. We’re passionate about A/B testing and validating hypotheses, as well as maintaining high standards of software quality and performance. We collaborate with teams across all parts of the product in order to drive customer engagement and retention.

As an Intermediate Software Developer on the Growth Labs team, You Can Expect to:

  • Work as part of a small cross-functional team with Product, Design, and Marketing counterparts to identify and deliver on opportunities to improve customer engagement metrics.
  • Deliver experiments and A/B tests on Vidyard’s website, sign-up flows, and across the product.
  • Iterate quickly while still maintaining high standards of code quality.
  • Work within and across teams to scope and build larger cross-cutting technical projects that boost our ability to deliver value to our customers.
  • Lead your teammates to write, test, and deploy scalable, performant code.
  • Work across the stack, shipping both front-end (Vue.js, React.js) and back-end (Node.js, Ruby on Rails) code and monitoring its performance.
  • Leverage design systems and best practices to ensure consistency.
  • Provide guidance and mentorship to more junior team members.
  • Help shape our longer-term technical roadmap and inform our product growth plans.
  • Level up our culture, our processes, and our best practices.

What You’ll Bring to this Role and Your New Team:

  • A solid background in software engineering—you have had 4+ years of experience shipping user-facing, scalable web products.
  • The ability to work across the software stack as a generalist, while still bringing in-depth experience to either front-end or back-end development.
  • A history of success delivering on user growth initiatives in an agile, iterative environment.
  • Past experience working at a SaaS Product Led Growth company.
  • Strong communication and collaboration skills—you strive for clarity and understanding, and you can navigate discussions around risks and tradeoffs.
  • The ability to drive improvements to our standards of quality, reliability, and performance.
  • Lean thinking and an experimental, metrics-driven mindset.
  • A high tolerance for ambiguity and a recognition that action is sometimes the best path to discovery.
  • An interest in customer experience and business metrics.
  • Experience mentoring others on your team.

Our Tech Stack

  • Version control - e.g. Git, Mercurial, SVN
  • Core web technologies - HTTP, HTML, CSS, JavaScript
  • Testing frameworks such as RSpec, Jest, Mocha
  • Modern front-end stacks - e.g. Webpack, Babel, Vue.js, React.js
  • Server technologies such as Node.js and Ruby on Rails
  • Relational Databases such as MySQL, PostgreSQL

Job descriptions can be overwhelming. At Vidyard we are motivated to drive change togetherand deeply value the unique experiences, abilities and opinions you possess, so if this role sounds like your next adventure, but you don’t feel entirely qualified, apply! We value candidates who own it, and if you’re relentlessly resourceful too, you might be exactly who we are looking for. 

As we also value user obsession, we prioritize our users, customers and community so you can expect to hear from our team even if you are not selected to move forward.

What You’ll Love about Vidyard:

  • Competitive pay
  • Comprehensive, flexible benefits on day one
  • Wellness allowance to spend on what's important to you 
  • Flexible hours, unlimited vacation, and programs to support travel while working, enabling you to live your best life
  • Access to Inkblot, a digital mental health platform + $1,500/person/year for mental health coverage
  • Allowance to support your ongoing growth and development
  • Paid volunteer hours
  • Employee resource groups to empower and drive change at Vidyard and in our communities
  • Flexible holiday program
  • Home office stipend 
  • Flexibility to work in the place that brings out your best: whether you thrive in the comfort of your home office, or are local to, and prefer the energy of our collaboration space in Kitchener, Ontario, Canada, there is flexibility for all. Although we default to remote-first there will be occasional in-person meetings/events purposefully designed for connection and collaboration.

We thank all applicants for your interest in Vidyard. Only those applicants selected for an interview will be contacted. Unsolicited resumes from Agencies will not be accepted.

Vidyard is an equal opportunity employer. Applicants who require reasonable accommodation to complete the application and/or interview process should notify us atrecruitment@vidyard.com.

See more jobs at Vidyard

Apply for this job

+30d

Developer Relations Engineer (Remote North America)

DataStaxSan Francisco, CA, Remote
pythonjavascriptNode.js

DataStax is hiring a Remote Developer Relations Engineer (Remote North America)

Job Description

Developer Relations Engineer (Accepting candidates from the US, preferably the Bay Area)

 

As the Developer Relations Engineer you will be responsible for

What you will do:

  • Function as a trusted expert on the Gen AI development space

  • Build high quality demos, examples, and educational technical content

  • Create short-form and long-form video content (shorts, webinars)

  • Speak at and participate in developer meetups, conferences and hackathons

  • Be active and involved in Python, JavaScript and Gen AI developer communities

  • Capture feedback on the developer experience (DX) and share internally

Your experience should include:

  • You care deeply about serving developers and helping them be successful
  • You have prior experience in an engineering or devrel role

  • You are an excellent technical writer

  • You are a comfortable public speaker

  • You love to create new app/experiences that are enabled by cutting edge technologies

  • You are proficient in either Python or Node.js

  • You are comfortable with modern web development and deployment

  • You are enjoy helping developers learn new concepts

 

Not sure if you qualify?

Apply anyway! We extend opportunities to a broad array of candidates, including those with diverse workplace experiences and backgrounds. Whether you're new to the corporate world, returning to work after a gap in employment, or simply looking to transition or take the next step in your career path, we are excited to connect with you.

 

Explore Roles

#LI-Remote

$124,114 - $186,172

Qualifications

See more jobs at DataStax

Apply for this job

+30d

Fullstack Engineer

UserTestingBarcelona - Remote
Designc++typescriptkubernetesNode.js

UserTesting is hiring a Remote Fullstack Engineer

We’re UserTesting, a leader in experience research and insights; we believe the path to human understanding and great experiences start with a shared understanding—seeing and hearing how another person engages with the world around them and taking in their perspective. Working at UserTesting, you will be empowered to help organizations  discover the human side of business–transforming how they work, collaborate, innovate, and bring new products and experiences to market. This is what inspires us, and it’s how we enable companies to connect with their audiences naturally and organically through an experience that is uniquely, and intentionally human.

A trusted company by top brands for 15+ years, UserTesting, recently merged with UserZoom, has over 3,400 customers in 50 countries, including 75 of the Fortune 100 companies. Joining our team means being part of a passionate group focused on transforming how companies learn from and understand their customers. Come join us and help us build the engine for human understanding.

The Opportunity

As part of the Engineering Team, you will have a great opportunity to contribute to building on our SaaS platform. Working alongside our global team you will be responsible for creating something truly amazing - the Human Insights industry is an exciting place to be right now. As UserTesting grows, so does our focus on your career and personal development. More importantly, the team here at UserTesting is both supportive and welcoming of new team members, with plenty of social events (if you like to get involved).

The Team

The Engineering team is an integral part of our organization, with members spanning many global locations. We are committed to building effective solutions, delivering for impact, always learning, and iteratively shaping the Product to transform the business, while growing a state-of-the-art SaaS platform in a scalable and reliable way.

What you will be doing

  • Collaborate with the team to understand project requirements and translate them into clear, concise code.
  • Write, test, and debug code using a variety of programming languages.
  • Conduct unit testing to ensure code functionality and identify potential issues.
  • Contribute to code reviews, providing constructive feedback and learning from senior engineers.
  • Approach problem-solving with a proactive and independent attitude.
  • Document code clearly and concisely to ensure maintainability and collaboration.
  • Stay up-to-date with the latest software development trends and technologies.
  • Learn and adapt to new technologies as needed.
  • Assist with debugging and troubleshooting technical issues.
  • May participate in some aspects of system design and architecture (depending on project needs).
  • Great communication skills, able to understand and clarify complex matters with non-technical colleagues.

What we are looking for

  • Bachelor’s degree in computer science or equivalent.
  • You have strong technical skills and solid conceptual foundations.
  • Experience with Typescript, Node.js, and/or the React ecosystem.
  • You like Distributed Software, Microservices, and Event-driven Cloud Architectures.
  • You are familiar with or interested in learning some of our toolset: GraphQL/Apollo, gRPC, Kafka, Mongo, Kubernetes, GitHub Actions, SingleSpa, Jotai, Jest/Cypress.
  • You are in for the challenge of building highly reliable & scalable systems.
  • You are eager to learn, screen those learnings, and apply the best suited for a bounded context.
  • You have experience in discussing, spiking & benchmarking Engineering solutions.
  • You speak fluent English.
  • Familiarity with Reactive & Domain Driven Architectures.
  • Demonstrates UserTesting’s values through work product and within day-to-day team interactions.

What we offer

- Employee Assistance Program (EAP)
- Health Insurance
- Flexible retribution
- Employee Referral Program
- Professional Development Stipend
- Remote work stipend
- Wellness reimbursement 
- Volunteer days

To learn more about our team, culture, and customers, check out ourcareers page,company blog, andpress/awards. Aside from a great work environment and the opportunity to make an impact, we’re also growing the team quickly–join us!

At UserTesting, we are committed to providing more inclusive and accessible experiences for our candidates. We pride ourselves on building empathy; diverse perspectives, which we believe are the key values to creating exceptional experiences for everyone. Our commitment to providing accessible experiences is driven by this belief and our core values. If you require any accommodations or have any specific requests about how we could tailor our interview process to better suit your needs please contact us on:talentexperience@usertesting.com.If you need to speak to someone please ask!

******

UserTesting is an Equal Opportunity Employer and a participant in the U.S. Federal E-Verify program.  Women, minorities, individuals with disabilities and protected veterans are encouraged to apply.  We welcome people of different backgrounds, experiences, abilities and perspectives.  

UserTesting will consider qualified applicants with criminal histories in a manner consistent with the San Francisco Fair Chance Ordinance, as applicable.  

We welcome candidates with physical, mental, and/or neurological disabilities. If you require assistance applying for an open position, or need accommodation during the recruiting process due to a disability, please submit a request to People Operations by emailingaskPeopleOps@usertesting.com.

See more jobs at UserTesting

Apply for this job

+30d

Développeur Back-End

VoskerMontreal, Canada, Remote
golangmongodbscrumgittypescriptlinuxpythonjavascriptbackendNode.js

Vosker is hiring a Remote Développeur Back-End

Description du poste

  • Entretenir et développer les services « backend » pour les applications web;
  • Proposer des solutions technologiques créatives;
  • Collaborer avec les différentes équipes afin de créer des produits innovateurs et attrayants;
  • Soulever les enjeux techniques et proposer des solutions afin de les surmonter;
  • Participer aux diverses facettes du développement : architecture, tests, optimisation, évolution et correction d’anomalies;

Participer aux activités de la méthodologie Scrum

Qualifications

  • JavaScript (ES6+)
  • Typescript
  • Node.js;
  • Python et golang;
  • MongoDB et Kafka
  • Bitbucket et Confluence ;
  • Git ;
  • Linux ;
  • Docker.

See more jobs at Vosker

Apply for this job

+30d

Staff Site Reliability Engineer

MozillaRemote US
6 years of experienceterraformairflowsqlDesignansibleazurejavac++openstackdockerelasticsearchkubernetesjenkinspythonAWSbackendNode.js

Mozilla is hiring a Remote Staff Site Reliability Engineer


Why Mozilla?

Mozilla Corporation is the non-profit-backed technology company that has shaped the internet for the better over the last 25 years. We make pioneering brands like Firefox, the privacy-minded web browser, and Pocket, a service for keeping up with the best content online. Now, with more than225million people around the world using our products each month, we’re shaping the next 25 years of technology. Our work focuses on diverse areas including AI, social media, security and more. And we’re doing this while never losing our focus on our core mission – to make the internet better for everyone. 

The Mozilla Corporation is wholly owned by the non-profit 501(c) Mozilla Foundation. This means we aren’t beholden to any shareholders — only to our mission. Along with thousands of volunteer contributors and collaborators all over the world, Mozillians design, build and distributeopen-sourcesoftware that enables people to enjoy the internet on their terms. 

About this team and role:

Mozilla’s Release SRE Team is looking for a Staff SRE to help us build and maintain infrastructure that supports Mozilla products. You will combine skills from DevOps/SRE, systems administration, and software development to influence product architecture and evolution by crafting reliable cloud-based infrastructure for internal and external services.

As a Staff SRE you will work closely with Mozilla’s engineering and product teams and participate in significant engineering projects across the company. You will collaborate with hardworking engineers across different levels of experience and backgrounds. Most of your work will involve improving existing systems, building new infrastructure, evaluating tools and eliminating toil.

What you’ll do:

  • Manage infrastructure in AWS and GCP
  • Write, maintain, and expand automation scripts, metrics and monitoring tooling, and orchestration recipes
  • Lead otherSREs and software development teams to deliver products with an eye on reliability and automation
  • Demonstrate accountability in the delivery of work
  • Spot and raise potential issues to the team
  • Be on-call for production services and infrastructure
  • Be trusted to resolve unclear but urgent tasks
What you’ll bring:
  • Degree and 6 years of experience related to either backend software development or cloud operations or experience related DevOps/SRE
  • Experience programming in at least one of the following languages: Python, Java, C/C++, Go, Node.js or Rust. 
  • Involvement in running services in the cloud
  • Kubernetes administration and optimization
  • Proven understanding of database systems (SQL and/or non-relational databases)
  • Infrastructure As Code and Configuration as Code tooling (Puppet, Chef, Ansible, Salt, Terraform, Amazon Cloudformation or Google Cloud Deployment Manager)
  • Strong communication skills
  • Curiosity and interest in learning new things
  • Commitment to our values:
    • Welcoming differences
    • Being relationship-minded
    • Practicing responsible participation
    • Having grit
Bonus points for…
  • CI/CD orchestration (Jenkins, CircleCI, or TravisCI)
  • ETL, data modeling, cloud-based data storage, processing
  • GCP Data Services (Dataflow, BigQuery, Dataproc)
  • Workflow and data pipeline orchestration (Airflow, Oozie, Jenkins, etc)
  • Container orchestration technologies (Kubernetes, OpenStack, Docker swarm, etc)
  • Open source software involvement
  • Monitoring/Logging with technologies like Splunk, ElasticSearch, Logstash/Fluentd, Stackdriver, Time-series databases like InfluxDB etc.

What you’ll get:

  • Generous performance-based bonus plans to all regular employees - we share in our success as one team
  • Rich medical, dental, and vision coverage
  • Generous retirement contributions with 100% immediate vesting (regardless of whether you contribute)
  • Quarterly all-company wellness days where everyone takes a pause together
  • Country specific holidays plus a day off for your birthday
  • One-time home office stipend
  • Annual professional development budget
  • Quarterly well-being stipend
  • Considerable paid parental leave
  • Employee referral bonus program
  • Other benefits (life/AD&D, disability, EAP, etc. - varies by country)

About Mozilla 

Mozilla exists to build the Internet as a public resource accessible to all because we believe that open and free is better than closed and controlled. When you work at Mozilla, you give yourself a chance to make a difference in the lives of Web users everywhere. And you give us a chance to make a difference in your life every single day. Join us to work on the Web as the platform and help create more opportunity and innovation for everyone online.

Commitment to diversity, equity, inclusion, and belonging

Mozilla understands that valuing diverse creative practices and forms of knowledge are crucial to and enrich the company’s core mission.  We encourage applications from everyone, including members of all equity-seeking communities, such as (but certainly not limited to) women, racialized and Indigenous persons, persons with disabilities, persons of all sexual orientations,gender identities, and expressions.

We will ensure that qualified individuals with disabilities are provided reasonable accommodations to participate in the job application or interview process, to perform essential job functions, and to receive other benefits and privileges of employment, as appropriate. Please contact us at hiringaccommodation@mozilla.com to request accommodation.

We are an equal opportunity employer. We do not discriminate on the basis of race (including hairstyle and texture), religion (including religious grooming and dress practices), gender, gender identity, gender expression, color, national origin, pregnancy, ancestry, domestic partner status, disability, sexual orientation, age, genetic predisposition, medical condition, marital status, citizenship status, military or veteran status, or any other basis covered by applicable laws.  Mozilla will not tolerate discrimination or harassment based on any of these characteristics or any other unlawful behavior, conduct, or purpose.

Group: C

#LI-REMOTE

Req ID: R2515

Hiring Ranges:

US Tier 1 Locations
$163,000$239,000 USD
US Tier 2 Locations
$150,000$220,000 USD
US Tier 3 Locations
$138,000$203,000 USD

See more jobs at Mozilla

Apply for this job

+30d

Senior Web Engineer / Developer

Integrity Web ConsultingUniversity City, MO, Remote
wordpressdrupalmobilesassiossymfonygitandroidcssjavascriptNode.jsPHP

Integrity Web Consulting is hiring a Remote Senior Web Engineer / Developer

Job Description

Join a team of experienced professionals crafting effective web solutions for clients ranging from Silicon Valley start-ups to Chicago private equity firms to Nashville healthcare companies to leading local St. Louis firms.

Integrity's Developers partner with user experience designers, digital marketers and content strategists to solve challenging problems for our clients by designing/developing world-class web-based solutions - including custom web applications, iOS mobile apps and Android mobile apps.

Qualifications

We hire to character and train to skills, but the ideal team member will have  experience with most of the following:

  • Strategic thinker with exceptional soft skills
  • Passion for quality code
  • Desire to learn daily
  • Fearless problem solver
  • Believes this is a craft, not just a job
  • Node.js, advanced Javascript, react.js, full stack if possible
  • PHP (Zend, Symfony, Codeigniter) or other MVC framework
  • Experience with web CMS such as WordPress, Drupal or DNN
  • LESS, SASS, etc.
  • Excellent verbal and written communication skills
  • Enjoy a highly collaborative work environment
  • Desire and ability to learn on a daily basis
  • Firm understanding of object-oriented programming
  • Git, SVN or other version control system
  • HTML, JavaScript, CSS, JSON experience
  • Ability to write unit tests
  • Experience with continuous integration

See more jobs at Integrity Web Consulting

Apply for this job

+30d

Sr. Full-Stack Developer (React.js, Next.js, MySQL and AWS) AI/ML

iSpace, Inc.Los Angeles, CA, Remote
sqlDesignmobileapimysqlcssangularAWSjavascriptNode.js

iSpace, Inc. is hiring a Remote Sr. Full-Stack Developer (React.js, Next.js, MySQL and AWS) AI/ML

Job Description

Sr. Full-Stack Developer (React.js, Next.js, MySQL and AWS)
Location : Full remote, but work PST time zone
Duration : 6-12 Months Contract


Description:
Seeking a creative Senior Developer that can architect and develop large scale enterprise applications using React.js for front-end, Next.js, MySQL for backend. Will be working closely with a team of developers to validate and/or test new technologies to progress the efficiencies of the technical landscape.

Requirements:

  • 7+ years of experience building complex web applications
  • Solid work experience using component-based development on the client side
  • 7+ years of experience developing single page applications
  • 3+ years of experience with Next.js
  • 3+ years of experience coding robust and secure Rest API's in Node.js, JSON, XML
  • 5+ years of experience working with MySQL (or SQL Server) designing schemas and writing optimized queries
  • 7+ years of experience coding in JavaScript, HTML, CSS
  • 3+ years of experience developing in React.js and Redux. Prior to that some experience in Angular or Backbone or Knockout or Ember.
  • 5+ years of experience integrating systems using Rest APIs and single sign-on
  • 7+ years of experience with automated unit, integration and end-to-end testing
  • Experience with continuous integration / continuous deployment using AWS CodePipeline and CloudFormation templates
  • Experience with AWS infrastructure (API Gateway, S3, Lambda, Aurora, EC2)
  • Experience with Google Analytics integration
  • Deep knowledge to create standards-compliant, cross-browser, mobile compatible front-end code with responsive design
  • Deep knowledge of server-side and front-end performance optimization
  • Strong design skills a huge plus
  • Should be a self-starter who is excited to relentlessly solve many technical challenges
  • Must have excellent written and verbal communication skills
  • Should manage own time and work well both independently and as part of a team

Qualifications

See more jobs at iSpace, Inc.

Apply for this job

+30d

Principal Engineer

WebflowU.S. Remote
nosqlDesigngraphqlc++dockertypescriptkubernetespythonjavascriptbackendfrontendNode.js

Webflow is hiring a Remote Principal Engineer

At Webflow, our mission is to bring development superpowers to everyone. Webflow is the leading visual development platform for building powerful websites without writing code. By combining modern web development technologies into one platform, Webflow enables people to build websites visually, saving engineering time, while clean code seamlessly generates in the background. From independent designers and creative agencies to Fortune 500 companies, millions worldwide use Webflow to be more nimble, creative, and collaborative. It’s the web, made better. 

 

We are looking for a Principal Engineer, reporting to our CTO. The Principal Engineer is a seasoned expert with an exceptionally strong technical and functional background, consistently incorporating emerging technologies into engineering products and best practices. Recognized as a subject matter expert, they lead major Engineering projects and strategic initiatives, showcasing in-depth knowledge of industry trends and effectively communicating complex technical issues. This individual contributes significantly to long-term strategic business thinking and drives Engineering innovation. With an expert ability to identify and advocate for strategic changes, they play a key role in shaping Webflow's architecture and guiding the company's future. They model and encourage the expression of diverse ideas and opinions and drive the engineering culture internally and promote it externally to help attract world-class talent. 

About the role 

  • Location: San Francisco HQ or US remote
  • Full-time
  • The cash compensation for this role is tailored to align with the cost of labor in different US geographic markets. The base pay for this role ranges from $234,900 in our lowest geographic market up to $341,600 in our highest geographic market. These figures are in $USD and apply to candidates in the United States. The specific base pay within the range will be determined by the candidate’s geographic location, job-related experience, knowledge, qualifications, and skills.

As a Principal Engineeryou’ll:

  • Drive engineering innovation across the entire company
  • Stay abreast of industry trends and emerging technologies
  • Spearhead research initiatives to explore new tools, frameworks, and methodologies
  • Guide the approach and execution of a particular team or group of teams
  • Dig deep into arbitrarily complex and critical problems and find an appropriate path forward until resolution
  • Collaborate with product managers, designers, and other stakeholders to understand requirements to architect, design and deliver high-quality solutions
  • Conduct thorough architectural reviews to help guide and shape Webflow’s technology stack
  • Be a model for engineering innovation in the industry working with partners, customers, and investors
  • Mentor and coach other engineers, fostering a culture of continuous learning
  • Exemplify Webflow’s Core Behaviors in the pursuit of our mission to democratize software development

That said, these role responsibilities are just the start! At Webflow, we encourage you to contribute wherever your interests take you — and shape your role accordingly. 

About you

You’ll thrive as a Principal Engineer if:

  • You have a genuine passion for building platforms for web applications and scalable web frameworks 
  • You have exhibit proficiency in a diverse set of programming languages such as JavaScript, TypeScript, and Python
  • You have hands-on experience with modern web technology such as React, Node.js, Tailwind.css, and frameworks such as Next.js and Remix
  • You possess a deep understanding of monorepos, microservices architecture and cloud technologies
  • You showcase strong expertise in database design and optimization, with a focus on NoSQL databases, particularly mongoDB.
  • You have a solid grasp of containerization and orchestration tools like Docker and Kubernetes and extensive experience designing RESTful APIs, GraphQL APIs, and integrating third-party APIs
  • You have a thorough understanding of security best practices in software development
  • You should be well-versed in both frontend and backend technologies, combining a comprehensive skill set with a love for crafting highly technical and innovative solutions for web development
  • You are committed to cultivating an inclusive team culture

Our Core Behaviors:

  • Obsess over customer experience. We deeply understand what we’re building and who we’re building for and serving. We define the leading edge of what’s possible in our industry and deliver the future for our customers.
  • Move with heartfelt urgency. We have a healthy relationship with impatience, channeling it thoughtfully to show up better and faster for our customers and for each other. Time is the most limited thing we have, and we make the most of every moment.
  • Say the hard thing with care. Our best work often comes from intelligent debate, critique, and even difficult conversations. We speak our minds and don’t sugarcoat things — and we do so with respect, maturity, and care.
  • Make your mark. We seek out new and unique ways to create meaningful impact, and we champion the same from our colleagues. We work as a team to get the job done, and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates.

Benefits & wellness

  • Equity ownership (RSUs) in a growing, privately-owned company
  • 100% employer-paid healthcare, vision, and dental insurance coverage for employees and dependents (US; full-time Canadian workers working 30+ hours per week), as well as Health Savings Account/Health Reimbursement Account, dependent on insurance plan selection. Employees also have voluntary insurance options, such as life, disability, hospital protection, accident, and critical illness
  • 12 weeks of paid parental leave for both birthing and non-birthing caregivers, as well as an additional 6-8 weeks of pregnancy disability for birthing parents to be used before child bonding leave. Employees also have access to family planning care and reimbursement
  • Flexible PTO with an mandatory annual minimum of 10 days paid time off, and sabbatical program
  • Access to mental wellness coaching, therapy, and Employee Assistance Program
  • Monthly stipends to support health and wellness, as well as smart work, and annual stipends to support professional growth
  • Professional career coaching, internal learning & development programs
  • 401k plan and financial wellness benefits, like CPA or financial advisor coverage
  • Commuter benefits for in-office workers

Temporary employees are not eligible for paid holiday time off, accrued paid time off, paid leaves of absence, or company-sponsored perks.

Be you, with us

At Webflow, equality is a core tenet of our culture. We are committed to building an inclusive global team that represents a variety of backgrounds, perspectives, beliefs, and experiences. Employment decisions are made on the basis of job-related criteria without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability, veteran status, or any other classification protected by applicable law.

Stay connected

Not ready to apply, but want to be part of the Webflow community? Consider following our story on our Webflow Blog, LinkedIn, Twitter, and/or Glassdoor. 

Please note:

To join Webflow, you'll need valid U.S. or Canadian work authorization depending on the country of employment.

If you are extended an offer, that offer may be contingent upon your successful completion of a background check, which will be conducted in accordance with applicable laws. We may obtain one or more background screening reports about you, solely for employment purposes.

See more jobs at Webflow

Apply for this job

+30d

Senior Backend Engineer, SP Success

WebflowU.S. Remote
agileremote-firstgraphqlapiqac++AWSjavascriptbackendNode.js

Webflow is hiring a Remote Senior Backend Engineer, SP Success

At Webflow, our mission is to bring development superpowers to everyone. Webflow is the leading visual development platform for building powerful websites without writing code. By combining modern web development technologies into one platform, Webflow enables people to build websites visually, saving engineering time, while clean code seamlessly generates in the background. From independent designers and creative agencies to Fortune 500 companies, millions worldwide use Webflow to be more nimble, creative, and collaborative. It’s the web, made better. 

We are looking for a Senior Backend Engineer to join the SP Success team and further our mission of bringing visual development superpowers to everyone and to build thriving businesses on top of Webflow. 

About the role 

  • Location: Remote-first (United States; BC & ON, Canada) 
  • Full-time 
  • Permanent
  • Exempt 
  • The cash compensation for this role is tailored to align with the cost of labor in different geographic markets. We've structured the base pay ranges for this role into zones for our geographic markets, and the specific base pay within the range will be determined by the candidate’s geographic location, job-related experience, knowledge, qualifications, and skills.
    • United States  (all figures cited below in USD and pertain to workers in the United States)
      • Zone A: $162,500 - $216,050
      • Zone B: $152,700 - $203,100
      • Zone C: $143,00 - $190,150 
    • Canada  (All figures cited below in CAD and pertain to workers in ON & BC, Canada)
      • CAD 184,600 - CAD 245,500
  • Please visit our Careers page for more information on which locations are included in each of our geographic pay zones. However, please confirm the zone for your specific location with your recruiter.

  • Reporting to the Engineering Manager 

As Senior Backend Engineer, you’ll: 

  • Develop a comprehensive knowledge of how areas of business, such as architecture and infrastructure, integrate to accomplish our business goals.
  • Build amazing end-to-end API and developer experiences, ensuring that they are reliable and scalable 
  • Write scalable services, as well as new APIs and rewriting old ones, in Node.js, Express.js, Mongo, GraphQL, Apollo and AWS Lambda. We use Javascript and Typescript.
  • Collaborate with software engineers, product managers, designers, and QA analysts in an autonomous, supportive team environment
  • Solve problems in a highly technical platform that empowers hundreds of thousands of people
  • Improve our planning, development, and deployment processes to help you and your fellow team members
  • Mentor, coach, and inspire a team of engineers of various levels

In addition to the responsibilities outlined above, at Webflow we will support you in identifying where your interests and development opportunities lie and we'll help you incorporate them into your role.

About you 

You’ll thrive in this role if you:

  • Have 5+ years developing and deploying web applications, with a proven track record of shipping to market.
  • Excellent organization and communication skills, both verbal and written.
  • Have worked on complex issues where the analysis requires an in-depth knowledge of the company and existing architecture.
  • Can debug production issues across services and multiple levels of the stack
  • Take pride in taking ownership and driving projects to business impact
  • Proven experience building complex web systems.
  • Are familiar with one or more Javascript type systems (we use Flow here)
  • Are comfortable working in an agile, safe-to-fail environment

 

Our Core Behaviors:

  • Obsess over customer experience.We deeply understandwhatwe’re building andwhowe’re building for and serving. We define the leading edge of what’s possible in our industry and deliver the future for our customers.
  • Move with heartfelt urgency.We have a healthy relationship with impatience, channeling it thoughtfully to show up better and faster for our customers and for each other. Time is the most limited thing we have, and we make the most of every moment.
  • Say the hard thing with care.Our best work often comes from intelligent debate, critique, and even difficult conversations. We speak our minds and don’t sugarcoat things — and we do so with respect, maturity, and care.
  • Make your mark.We seek out new and unique ways to create meaningful impact, and we champion the same from our colleagues. We work as ateamto get the job done, and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates.

Benefits & wellness

  • Equity ownership (RSUs) in a growing, privately-owned company
  • 100% employer-paid healthcare, vision, and dental insurance coverage for employees and dependents (full-time employees working 30+ hours per week), as well as Health Savings Account/Health Reimbursement Account, dependent care Flexible Spending Account (US only), dependent on insurance plan selection where applicable in the respective country of employment; Employees may also have voluntary insurance options, such as life, disability, hospital protection, accident, and critical illness where applicable in the respective country of employment
  • 12 weeks of paid parental leave for both birthing and non-birthing caregivers, as well as an additional 6-8 weeks of pregnancy disability for birthing parents to be used before child bonding leave (where local requirements are more generous employees receive the greater benefit); Employees also have access to family planning care and reimbursement
  • Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations (where local requirements are more generous employees receive the greater benefit), and sabbatical program
  • Access to mental wellness and professional coaching, therapy, and Employee Assistance Program
  • Monthly stipends to support health and wellness, smart work, and professional growth
  • Professional career coaching, internal learning & development programs
  • 401k plan and pension schemes (in countries where statutorily required) financial wellness benefits, like CPA or financial advisor coverage
  • Discounted Pet Insurance offering (US only)
  • Commuter benefits for in-office employees

Be you, with us

At Webflow, equality is a core tenet of our culture. We are an Equal Opportunity (EEO)/Veterans/Disabled Employer and are committed to building an inclusive global team that represents a variety of backgrounds, perspectives, beliefs, and experiences. Employment decisions are made on the basis of job-related criteria without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability, veteran status, or any other classification protected by applicable law. Pursuant to the San Francisco Fair Chance Ordinance, Webflow will consider for employment qualified applicants with arrest and conviction records.

Stay connected

Not ready to apply, but want to be part of the Webflow community? Consider following our story on our Webflow Blog, LinkedIn, X (Twitter), and/or Glassdoor.

Please note:

To join Webflow, you'll need valid U.S. or Canadian work authorization depending on the country of employment.

If you are extended an offer, that offer may be contingent upon your successful completion of a background check, which will be conducted in accordance with applicable laws. We may obtain one or more background screening reports about you, solely for employment purposes.

For information about how Webflow processes your personal information, please reviewWebflow’s Applicant Privacy Notice

See more jobs at Webflow

Apply for this job

+30d

Desenvolvedor Front-end React PL/SR (remoto)

SossegoHome-office, Brazil, Remote
postgressqlDesignscrumUXgitdockermysqltypescriptcssangularreduxNode.js

Sossego is hiring a Remote Desenvolvedor Front-end React PL/SR (remoto)

Descrição da vaga

A função "Desenvolvedor Front-end (React)" é responsável por atuar em atividades de desenvolvimento e manutenção de sistemas da Sossego. 

Os principais processos realizados são:

  • Análise
  • Prototipação
  • Desenvolvimento
  • Testes
  • Homologação
  • Manutenção

O trabalho é realizado em uma Squad com outros papéis de tecnologia e produtos.

Sobre o gerenciamento das demandas, varia de acordo com a modalidade de envolvimento que você estiver: 

  • Tempo integral:
    • Participação nos rituais SCRUM (dailys, reviews, ...)
  • Sob-demanda:
    • Estimativa de prazo e esforço das solicitações
    • Time-sheet de execução

Qualificações

Quais os requisitos obrigatórios desta vaga?

  • Alinhamento verdadeiro ao A.C.H.E. explicado acima
  • Experiência em UX (usabilidade, design, jornada)
  • Experiência com Prototipação (e suas ferramentas)
  • Experiência com GIT, e uso do GitHub
  • Experiência com HTML, CSS
  • Experiência com React, Redux
  • Experiência com Node.js / TypeScript
  • Experiência com APIs (criação, uso, depuração)
  • Experiência com ferramentas online de desenvolvimento e suporte
  • Conhecimento SCRUM
  • Facilidade de comunicação

Quais habilidade serão consideradas um diferencial?

  • Experiência com outros frameworks (Angular, etc)
  • Experiência com Grunt, Gulp, Webpack, etc
  • Experiência com Docker
  • Experiência com SQL (MySQL, Postgres)
  • Experiência em automatização de testes
  • Experiência em edição de imagens
  • Conhecimento em DevOps, CI-CD
  • Conhecimento com ambiente Cloud
  • Conhecimento em segurança de sistemas

See more jobs at Sossego

Apply for this job

+30d

Senior Full Stack Drupal Engineer

Agile SixRemote
agiledrupalDesignslackgraphqlapiUXqagitrubyc++cssjavascriptbackendfrontendNode.jsPHP

Agile Six is hiring a Remote Senior Full Stack Drupal Engineer

Agile Six is a people-first, remote-work company that serves shoulder-to-shoulder with federal agencies to find innovative, human-centered solutions. We build better by putting people first. We are animated by our core values of Purpose, Wholeness, Trust, Self-Management and Inclusion. We deliver our solutions in autonomous teams of self-managed professionals (no managers here!) who genuinely care about each other and the work. We know that’s our company’s purpose – and that we can only achieve it by supporting a culture where people feel valued, self-managed, and love to come to work.

The role

Agile Six is looking for a Senior Full Stack Drupal Engineer to join a highly collaborative Agile team. Our team works with the Department of Veterans Affairs to drive improvements to the Veteran experience across their digital platform, VA.gov.

Our ideal candidate has extensive recent Drupal experience with Drupal 9 and 10 and a strong grasp of object oriented principles of PHP. We are looking for an engineer with demonstrated experience learning new tools, languages and frameworks. We tackle a wide range of challenges and regularly step outside of our comfort zones — and are looking for a candidate excited to do the same. Most importantly, we are looking for someone who wants to work on important problems that have a lasting impact on millions of users and make a difference in our government!

Our work:

VA utilizes Drupal as an API which serves data to a number of systems. This team’s mission is to provide a modernized, accessible, single source of truth about available VA locations, services, and benefits to Veterans, as well as to provide a modernized, accessible Drupal CMS user experience to Editors creating and maintaining that content.

The VA follows the U.S. Digital Services Playbook and "Default to Open", therefore project repositories are fully open source:

Responsibilities

  • Collaborate with a remote cross-functional team to deliver well-performing and scalable services and components
  • Grasp the overall technical landscape and offer guidance on solution direction, architecture, and tradeoffs
  • Identify client needs and 'meet them where they are’ through empathy, mentorship and advice
  • Mitigate technical, resource, and timeline risks
  • Conduct peer code reviews, including evaluation of regression testing and test coverage, adherence to acceptance criteria, and code best practices
  • Complete high-complexity tasks both independently and collaboratively as neede
  • Participate in testing and QA, including writing of automated unit, system, performance, functional tests and manual testing efforts
  • Support the practice of engineering within the larger company as needed

We expect the responsibilities of this position to shift and grow organically over time, in response to considerations such as the unique strengths and interests of the selected candidate and other team members and an evolving understanding of the delivery environment.

Basic qualifications

  • 10+ years of full-time experience as a Software Engineer
  • 4+ years of production experience with Drupal
  • Experience using Composer
  • Experience writing PHPUnit, Kernel, and Functional tests
  • Experience working collaboratively in an Agile, cross-functional team
  • Solid foundation in software engineering fundamentals and best-practices, including object-oriented programming, design patterns, CICD, and writing automated tests and testable code
  • Experience working in different areas of the software stack and solving a variety of engineering problems
  • Ability to adapt to new languages and technologies to solve problems
  • Experience with accessibility requirements, standards, and testing tools
  • Experience with Git and GitHub or other source control systems
  • Has lived and worked in the United States for 3 of the last 5 years

Additional desired qualifications

  • Familiarity with GitHub Actions and their use in CI/CD workflows
  • Familiarity with modern Javascript and Node.js and an ability to contribute to a Javascript codebase
  • Familiarity with static site generators and other front-end frameworks (i.e. Next.js, Gatsby)
  • Experience with CSS Preprocessors
  • Familiarity with Section-508 and WCAG 2.1, Accessibility requirements, standards, and testing tools
  • Experience working with government agencies
  • You are a U.S. Veteran

 

Salary and Sixer Benefits

To promote equal pay for equal work, we publish salary ranges for each position.

The salary for this position is $159,839-$168,036

Our benefits are designed to reinforce our core values of Wholeness, Self Management and Inclusion. The following benefits are available to all employees. We respect that only you know what balance means for your life and season. While we offer support from coaches, we expect you to own your wholeness, show up for work whole, and go home to your family the same. You will be seen, heard and valued. We expect you to offer the same for your colleagues, be kind (not bossy), be caring (not directive) and ready to participate in a state of flow. We mean it when we say “We build better by putting people first”.

All Sixers Enjoy:

  • Self-managed work/life balance and flexibility
  • Competitive and equitable salary (equal pay for equal work)
  • Employee Stock Ownership (ESOP) for all employees!
  • 401K matching
  • Medical, dental, and vision insurance
  • Employer paid short and long term disability insurance
  • Employer paid life insurance
  • Self-managed and generous paid time off
  • Paid federal holidays and Election day off
  • Paid parental leave
  • Self-managed professional development spending
  • Self-managed wellness days

Hiring practices

Agile Six Applications, Inc. is an Equal Opportunity Employer. All qualified applicants will receive consideration for employment without regard to race, color, national origin, ancestry, sex, sexual orientation, gender identity or expression, religion, age, pregnancy, disability, work-related injury, covered veteran status, political ideology, marital status, or any other factor that the law protects from employment discrimination.

Note: We participate in E-Verify. Upon hire, we will provide the federal government with your Form I-9 information to confirm that you are authorized to work in the U.S. This role is required to work from the contiguous United States. Unfortunately, we are unable to sponsor visas at this time.

If you need assistance or reasonable accommodation in applying for any of these positions, please reach out to careers@agile6.com. We want to ensure you have the ability to apply for any position at Agile Six.

Please read and respond to the application questions carefully. Interviews are conducted on a rolling basis until the position has been filled.

 

Apply for this job

+30d

Stage Développeur Full-Stack (F/H)

ASINantes, France, Remote
mobileiosjavaandroidreact-nativeangularNode.js

ASI is hiring a Remote Stage Développeur Full-Stack (F/H)

Description du poste

Dans un souci d’accessibilité et de clarté, les termes employés au masculin se réfèrent aussi bien au genre féminin que masculin.  

Nous recherchons un Stagiaire Développeur Full-Stack pour intégrer notre équipe Nantaise.

Sous la responsabilité Nicolas, le tuteur dédié pour suivre votre évolution, vous rejoignez une team digitale dynamique pour intervenir sur l’ensemble du cycle de vie d’un projet interne, en contexte Agile.

Au quotidien :

  • Vous contribuez à la traduction des besoins fonctionnels en conceptions techniques
  • Vous participez à la réalisation des développements back et front
  • Vous réalisez des tests unitaires et d’intégration
  • Vous estimerez le reste à faire de vos développements en cours
  • Vous serez amené à faire des démos et participerez activement aux rétrospectives Scrum.
  • Vous participerez à la mise en place de l'intégration et du déploiement continu de votre projet.

Vous intervenez sur l’un ou plusieurs des environnements technologiques suivants :

  • Back-end : Java et tout son écosystème (Spring, Hibernate) ou Node.js
  • Front-end : React.js ou Angular ou autres frameworks js 
  • Mobile : Android ou IOS natif, React-Native ou Ionic

 

En rejoignant ASI,

  • Vous évoluerez dans une entreprise bientôt reconnue Société à mission, Team GreenCaring et non GreenWashing porteuse d’une démarche RSE incarnée et animée, depuis plus de 10 ans. (Equipe RSE dédiée, accord forfaits mobilités durables…) 
  • Vous intégrerez les différentes communautés expertes d'ASI, pour partager des bonnes pratiques et participer aux actions d'amélioration continue. 

Qualifications

Issu d’une formation supérieure en informatique en cours de validation (Bac+5), vous êtes à la recherche d’un stage de fin d’études d’une durée de 4 à 6 mois.

  • Le respect et l’engagement font partie intégrante de vos valeurs.
  • Attaché à la qualité de ce que vous réalisez, vous faites preuve de rigueur et d'organisation dans la réalisation de vos activités.
  • Vous avez l’esprit d’équipe et vos qualités relationnelles vous permettent de vous intégrer facilement au sein de l’équipe.

Le stage devant déboucher sur une proposition d'emploi concrète en CDI ou une possibilité de poursuivre en alternance

Désireux d’intégrer une entreprise à votre image, vous vous retrouvez dans nos valeurs de confiance, d’écoute, de plaisir et d’engagement. 

A compétences égales, ce poste est ouvert aux personnes en situation de handicap. 

 

See more jobs at ASI

Apply for this job

+30d

Middle/Senior Build Engineer

AcumaticaRemote
sqlmobilegit.netlinuxjenkinsNode.js

Acumatica is hiring a Remote Middle/Senior Build Engineer

Middle/Senior Build Engineer - Acumatica - Career Page

See more jobs at Acumatica

Apply for this job

+30d

Staff Governance Risk & Compliance Engineer

LatticeSF, NYC, Remote
remote-firstslackc++AWSNode.js

Lattice is hiring a Remote Staff Governance Risk & Compliance Engineer

This is Security at Lattice

As part of Lattice's security team, you will focus on implementing and enhancing GRC (governance, risk, and compliance) processes to mature, automate, and/or continuously monitor information security controls, exceptions, risks, and testing. Additionally, you will serve as an advisor, sounding board, and educator - collaborating with all areas of the business to understand business context, share knowledge, advise on compliance requirements and best practices. Our ideal candidate is a subject matter expert in a variety of GRC related areas, enjoys learning and taking on new challenges, and is a go-getter with a positive attitude and collaborative working style. 

What You Will Do

As a Staff GRC Engineer, you will be responsible for assessing (and driving the reduction of) corporate, production, and customer risk. You’ll work closely with others on the team, as well as colleagues in Legal, Procurement, Sales, IT, and Engineering to streamline processes, provide guidance, and advise on various security, compliance, and privacy controls. You’ll have a large amount of autonomy and an ability to make a significant impact in a successful, growing startup!

  • Policy, process, and standards generation, maintenance, and oversight
  • Security, compliance, and privacy training
  • Risk assessments and management
  • SOC2 audit facilitation and oversight
  • Third party risk assessments
  • Customer and vendor contract redlines / review
  • Customer questionnaire facilitation
  • Customer Trust Center oversight

What You Will Bring to the Table

There’s no such thing as a perfect candidate. We expect you to possess some combination of the following:

  • 10+ years of experience in security
  • 5+ years of experience focused on Governance, Risk, and Compliance
  • Ability to communicate company security posture effectively to customers through the use of a customer Trust Portal, pre-canned questionnaire responses, and customer calls (when appropriate)
  • Ability to communicate effectively with business representatives in explaining security, compliance, and risk related topics clearly
  • Ability to “lead from the front”, with a strong sense of ownership and ability to work autonomously, collaboratively within the security team, and effectively cross functionally
  • Experience implementing governance and compliance control tracking & reporting
  • Experience reviewing and redlining security terms within customer and vendor contracts
  • Experience evaluating vendor, organizational, and production service risks based upon regulatory requirements, industry standards, and best practices
  • Experience generating, operationalizing, and maintaining security and compliance policies, processes, and standards
  • Experience orchestrating SOC2 controls and audits
  • Experience orchestrating and/or implementing privacy related controls (GDPR, etc)
  • Experience implementing, administrating, and/or providing guidance on security related IT applications, such as Anti-Virus / Malware Protection, Endpoint Management, Access Management, VPN, and/or Network Proxy applications
  • High level understanding of Cloud and virtualized technology in environments such as AWS or GCP
  • High level understanding of common web protocols and components (node.js, databases)
  • High level understanding of authentication protocols and frameworks to include OAuth, OpenID, SSO/SAML, and AWS IAM
  • High level understanding of continuous integration / continuous deployment processes and tools

 

The estimated annual cash salary for this role is $128,000 - $200,000. This position is also eligible for incentive stock options, subject to the terms of Lattice’s applicable plans.

Benefits: The Company offers the following benefits for this position, subject to applicable eligibility requirements: Medical insurance; Dental insurance; Vision insurance; Life, AD&D, and Disability Insurance; Emergency Weather Support; Wellness Apps; Paid Parental Leave, Paid Time off inclusive of holidays and sick time; Commuter & Parking Accounts; Lunches in the Office; Workplace Amenities Stipend, Internet and Phone Stipend; One time WFH Office Set-Up Stipend; 401(k) retirement plan; Financial Planning; Learning & Development Budget; Sabbatical Program; and Invest in Your People Fund

*Note on Pay Transparency:

Lattice provides an estimate of the compensation for roles that may be hired as required by state regulations. Compensation may vary based on (a) location, as Lattice factors in specific location when benchmarking compensation for most roles; (b) individual candidate skills and qualifications; and (c) individual candidate experience.

Additionally, Lattice leverages current market data to determine compensation, so posted compensation figures are subject to change as new market data becomes available. The salary, other compensation, and benefits information is accurate as of the date of this posting. Lattice reserves the right to modify this information at any time, subject to applicable law.

#LI-Remote

About Lattice

Lattice is on a mission to build cultures where employees and their companies thrive. In an age where employees have more choices than ever before, businesses that put employees first are winning ????– and Lattice is building the tools to empower those people-centric companies.

Lattice is a people success platform that offers performance reviews, employee engagement surveys, real-time feedback, weekly check-ins, goal setting, and career planning in a way that allows companies to focus on employee development, growth, and engagement – yielding stronger employee retention, performance, and impact to the bottom line ????. Since launching in 2016, we have grown to over 5,000+ customers globally, including brands like Slack, Robinhood, and Gusto. 


Lattice is committed to equal treatment and opportunity in all aspects of recruitment, selection, and employment without regard to gender, race, religion, national origin, ethnicity, disability, gender identity/expression, sexual orientation, veteran or military status, or any other category protected under the law. Lattice is an equal opportunity employer; committed to a community of inclusion, and an environment free from discrimination, harassment, and retaliation.

By clicking the "Submit Application" button below, you consent to Lattice processing your personal information for the purpose of assessing your candidacy for this position in accordance withLattice's Job Applicant Privacy Policy.

Apply for this job

+30d

Principal Software Engineer II - Client Identity & Access Management (CIAM)

Stitch FixRemote, USA
golangagilepostgresDesigngraphqlrubypostgresqltypescriptcssjavascriptNode.js

Stitch Fix is hiring a Remote Principal Software Engineer II - Client Identity & Access Management (CIAM)

 

About the Role

We are looking for a seasoned Principal Engineer for our Client Identity & Access Management team. Your team will propose and build solutions for implementing secure authentication features along with authorization features for a household account. In Client Identity & Access Management Engineering, we are scaling our authentication system to provide a seamless authentication experience. We are also looking at expanding our customer base with a household account feature that will help drive features  and payments and discounts across multiple accounts. As a Principal Engineer, you will help shape the future of Stitch Fix’s Authentication & User Accounts systems. You will also be responsible for planning, building, and maintaining features and software in support of that future. 

Building valuable and sustainable software is a group activity. You will work within a distributed team of software engineers and cross-functional partners including product, design, algorithms, finance, etc. You're expected to have strong written communication skills and be able to develop strong working relationships with coworkers and business partners. You will need to know when and how to listen to, influence, coach, share with, advocate to, and lead others.

This is a remote position available within the United States. We operate in an agile-inspired manner; collaborating across multiple time zones. We build modern software with modern techniques like TDD, continuous delivery, DevOps, and service-oriented architecture. We focus on high-value products that solve clearly identified problems but are designed in a sustainable way and deliver long-term value. 

You’re excited about this opportunity because you will…

  • Operate as an engaged member of the engineering team - leading the designing of complex system designs, recommending solutions and 3rd party integrations, providing input on technical design documents & project plans, pairing with other engineers and stakeholders to work toward a solution, etc. 
  • Lead the collaboration with stakeholders while leading the execution of complex and/or critical projects within the Client Identity & Access Management team or across multiple engineering teams.
  • Model consistently sustainable results against measurable goals. 
  • Break down projects into actionable milestones.
  • Proactively communicate status updates or changes to the scope or timeline of projects to stakeholders and leadership.
  • Provide technical leadership, mentorship, pairing opportunities, timely feedback, and code reviews to encourage the growth of others.
  • Actively invest in the professional development and career growth of your teammates and peers.
  • Frame business problems using high-quality data analysis and empirical evidence for leadership.
  • Find new and better ways of doing things that align with business priorities.
  • Influence other engineers toward right-sized solutions.
  • Participate in on-call rotations and improve the on-call experience for others.
  • Help Stitch Fix continue to develop new methods of collaborating with partners across the organization.

We are excited about you because you... 

  • Have roughly 10+ years of professional programming experience.
  • Have extensive experience in the authentication space
  • Have hands-on experience with running Ruby on Rails, along with other modern web stacks (e.g. Node, React, Golang, Postgres, GraphQL, Kafka).
  • Have 3+ years of experience in technical leadership - including driving technical decisions and guiding broader project goals.
  • Are bright, kind, and motivated by challenge.
  • Have excellent analytical skills as well as communication skills both verbal and written.
  • Treasure helping your team members grow and learn.
  • Take initiative and operate with accountability.
  • Are motivated by solving problems and finding creative client-focused solutions.
  • Build high-quality solutions and are pragmatic about weighing project scope and value.
  • Are flexible, dedicated to your craft, and curious.
  • Have experience working remotely alongside a distributed software engineering team.
  • Might have experience with evolving a resilient distributed service architecture.
  • Might have experience with GraphQL schema design.
  • Might have prior experience with accessibility best practices.

Our Tech Stack Includes... 

  • Ruby, Rails, Golang and some Node.js 
  • GraphQL and PostgreSQL 
  • Kafka
  • React, JavaScript, TypeScript, CSS, HTML, Next.js

You'll Love Working At Stitch Fix Because We... 

  • Are a group of bright, kind people who are motivated by challenge. You can be your authentic self here, and are empowered to encourage others to do the same!
  • Value integrity, innovation, and trust. 
  • Are a technologically and data-driven business. 
  • Are at the forefront of tech and fashion, redefining shopping for the next generation. 
  • Are passionate about our clients and live/breathe the client experience. 
  • Get to be creative every day. 
  • Have a smart, experienced, and diverse leadership team that wants to do it right & is open to new ideas. 
  • Believe in autonomy & taking initiative. 
  • Full support for remote work & lean into async communications. 
  • Offer transparent, equitable, and competitive compensation based on your level to help eliminate bias in salaries, as well as equity and comprehensive health benefits. 
  • Are serious about our commitment to life-work balance, and have generous parental leave policies.

About Stitch Fix

We're changing the industry and bringing personal styling to every body. We believe in a service and a workplace where you can show up as your best, most authentic self. The Stitch Fix experience is not merely curated—it’s truly personalized to each client we style. We are changing the way people find what they love. We’re disrupting the future of retail with the precision of data science by combining it with human instinct to find pieces that fit our client’s unique style. This novel juxtaposition attracts a highly diverse group of talented people who are both thinkers and doers. This results in a simple, yet powerful offering to our customers and a successful, growing business serving millions of men, women and kids throughout the US. We believe we are only scratching the surface and are looking for incredible people like you to help us boldly create our future. 

Compensation and Benefits

Our anticipated compensation reflects the cost of labor across several US geographic markets, and the range below indicates the low end of the lowest-compensated market to the high end of the highest-compensated market. This position is eligible for new hire and ongoing grants of restricted stock units depending on employee and company performance. In addition, the position is eligible for medical, dental, vision, and other benefits. Applicants should apply via our internal or external careers site.
Salary Range
$226,000$240,000 USD

This link leads to the machine readable files that are made available in response to the federal Transparency in Coverage Rule and includes negotiated service rates and out-of-network allowed amounts between health plans and healthcare providers. The machine-readable files are formatted to allow researchers, regulators, and application developers to more easily access and analyze data.

Please review Stitch Fix's US Applicant Privacy Policy and Notice at Collection here: https://stitchfix.com/careers/workforce-applicant-privacy-policy

Recruiting Fraud Alert: 

To all candidates: your personal information and online safety are top of mind for us.  At Stitch Fix, recruiters only direct candidates to apply through our official career pages at https://www.stitchfix.com/careers/jobs or https://web.fountain.com/c/stitch-fix.

Recruiters will never request payments, ask for financial account information or sensitive information like social security numbers. If you are unsure if a message is from Stitch Fix, please email RecruitingOperations@stitchfix.com

You can read more about Recruiting Scam Awareness on our FAQ page here: https://support.stitchfix.com/hc/en-us/articles/1500007169402-Recruiting-Scam-Awareness 

 

See more jobs at Stitch Fix

Apply for this job

+30d

4-AI-Engineer

ApTaskPune, IN Remote
DesignpythonNode.js

ApTask is hiring a Remote 4-AI-Engineer

**Job Title: CTO & Co-Founder - AI Voice Agent for Recruiters**

Continue reading only if you have HANDS-ON experience developing AI/ML, LLM, RAG, and Vector Database tools. Some knowledge of AUDIO, SPEECH LLM models is a HUGE PLUS. Hands-on coding (or AI-generated code) using node.js, python experience. This is a startup and not a big corporation where you have to manage teams. You will have a small team of 2 to 3 developers and some freelancers. THIS IS NOT A MANAGEMENT JOB, THIS IS A CREATING SOFTWARE POSITION.

You can have two to three years of experience only but mostly in AI, ML, RAG, Pytorch, and AI-related hands-on projects. If you are from a failed startup background, EVEN BETTER.

**Location:** Remote (Candidate can be based anywhere with the ability to visit the USA as needed)

**Salary:** We will match your current salary

**Equity:** 10% vested over four years, with co-founder status

Company locations: We plan to setup a company in Saudi Arabia or Dubai. You will have TAX-free income.

**About Us:**

We are a forward-thinking startup poised to revolutionize the recruitment industry through innovative AI technology. Our mission is to develop an AI voice agent tailored specifically for recruiters, leveraging the latest advancements in AI, ML, and LLM (Large Language Models). We are committed to building a platform that streamlines recruitment processes, enhances communication, and delivers exceptional results.

**Job Description:**

As the CTO and co-founder, you will play a crucial role in shaping the technological direction of our company. We are seeking a visionary leader with expertise in AI, ML, and related technologies, including audio and speech processing, TTS (Text-to-Speech), and STT (Speech-to-Text). Your primary responsibility will be to lead the development of our AI voice agent platform, utilizing tools such as Hugging Face for experimenting with open-source LLMs, and training models, and customizing them to suit our business needs. Knowledge of embeddings and vector databases is essential, and familiarity with GPTCache or caching commonly used answers and audio files to reduce latency is a significant plus. You have to have hands-on experience in all of these technologies or be willing to get your hands dirty with the required coding and designing the architecture.

**Key Responsibilities:**

- Lead the design, development, and implementation of our AI voice agent platform.

- Utilize your expertise in AI, ML, and LLM to experiment with open-source models and customize them for our business case.

- Integrate audio and speech processing capabilities, including TTS and STT functionalities, into our platform.

- Collaborate with cross-functional teams to define technical requirements, prioritize features, and drive product development.

- Stay updated on the latest advancements in AI technology, incorporating emerging trends and best practices into our product roadmap.

- Leverage tools such as Hugging Face for experimenting with LLMs, training models, and customizing them to meet our specific requirements.

- Implement embeddings and vector databases to optimize data storage and retrieval processes.

- Knowledge of GPU-based hosting companies is a good to have

**Requirements:**

- Strong background in AI, ML, and related fields, with expertise in audio and speech processing.

- Proficiency in LLMs and experience with tools like Hugging Face for experimenting with open-source models.

- Knowledge of TTS and STT technologies, including hands-on experience with platforms like Eleven Labs (https://www.eleven-labs.com/), Play.ht (https://play.ht/), and Deepgram (https://www.deepgram.com/).

- Experience with embeddings and vector databases, with the ability to optimize data storage and retrieval processes.

- Familiarity with GPTCache or similar technologies for caching commonly used answers and audio files to reduce latency.

- Use call recordings and transcripts of all recruiting calls by AI agents for re-training models in a continuous way to make our LLM the smartest AI recruiter and able to handle any objections and be more creative.

**Benefits:**

- Competitive salary matching current compensation.

- 10% equity vested over four years, with co-founder status.

- Flexible remote work arrangement with the opportunity to visit the USA as needed.

- Opportunity to work on groundbreaking technology that has the potential to revolutionize the recruitment industry.

List of companies trying to do the same but for different industries.

synthflow.ai, vodex.ai, vocode.dev, Bland.ai, bolna.dev, trysetter.com

**Note:** This job posting is for informational purposes only and does not constitute a formal job offer.

See more jobs at ApTask

Apply for this job

+30d

Middle Full Stack Developer (React+Node.js)

Sigma SoftwareWarsaw, Poland, Remote
DesignazuregraphqltypescriptAWSNode.js

Sigma Software is hiring a Remote Middle Full Stack Developer (React+Node.js)

Job Description

  • Design and implement large-scale software solutions and components using multiple technologies (React and Node.js are the main ones) 
  • Do everything needed to keep a high level of quality 
  • Be a great communicator to be able to actively collaborate and get context for complex tasks 
  • Follow best engineering practices and company/client guidelines 
  • Play supervisory, advisory, and coaching roles for less-senior engineers in the team 
  • Promote clean code and design patterns/principles 

Qualifications

  • 4+ years of software development experience 
  • Strong experience in designing distributed and secure systems 
  • Strong experience with NodeJS/React/Redux on large-scale applications  
  • Good knowledge of micro-services architectures 
  • Experience designing, building, and maintaining APIs 
  • Experience in building and consuming REST and/or GraphQL APIs 
  • Comfortable with DevOps practices 
  • Experience working within a Cloud Provider (AWS, GCP, Azure, etc.)                   
  • Good knowledge testing best practices 
  • At least an Upper-Intermediate level of English 

WILL BE A PLUS

  • Modern JavaScript/ES6 libraries  
  • Experience working with TypeScript        
  • Experience with AWS 

See more jobs at Sigma Software

Apply for this job