person looking for a Jenkins Remote jobs

Get Remote Jenkins jobs in your mailbox.

726 exciting remote jobs on file from 2500+ top remote companies.

  • Hot new jobs of this week
  • 726 active jobs from past weeks to consult
  • Segmented for USA, Europe or Worldwide.
  • Personally selected for you by our experienced remote hiring managers.


Jobs featured in previous email 13 April

9d

Embedded Back-end NodeJS Developer/Architect

MobicaSkierniewicka 1, 01-230 Warszawa, Poland, Remote
9d

Sr SDET (Java Expert) - 100% Remote

Xyant Technology, Inc.TX-1604 Loop, San Antonio, TX, USA, Remote
agileuiqajavajenkins
9d

MuleSoft Admin

CentrapriseI-65, Columbus, IN, USA, Remote
apidockerkuberneteslinuxjenkinsAWS
9d

Sr. Python Developer

Robots & PencilsQuebec City, QC, Canada, Remote
jiramobilegitjenkinspython
10d

Software Engineer

Menlo SecurityRaleigh, NC (REMOTE)
jirapostgresDesignhtml5apigitmysqljenkinspythonAWSjavascriptbackendNode.js
10d

Software Engineer

Menlo SecuritySeattle, WA (REMOTE)
jirapostgresDesignhtml5apigitmysqljenkinspythonAWSjavascriptbackendNode.js
10d

Software Engineer

Menlo SecurityNashville, TN (REMOTE)
jirapostgresDesignhtml5apigitmysqljenkinspythonAWSjavascriptbackendNode.js
10d

Software Engineer

Menlo SecurityChicago, IL (REMOTE)
jirapostgresDesignhtml5apigitmysqljenkinspythonAWSjavascriptbackendNode.js
10d

Software Engineer

Menlo SecurityBoise, ID (REMOTE)
jirapostgresDesignhtml5apigitmysqljenkinspythonAWSjavascriptbackendNode.js
10d

Software Engineer

Menlo SecurityMilwaukee, WI (REMOTE)
jirapostgresDesignhtml5apigitmysqljenkinspythonAWSjavascriptbackendNode.js
10d

Senior DevOps Engineer

McFadyen DigitalFlorianópolis, State of Santa Catarina, Brazil, Remote
agilesqloracleDesigngitmysqllinuxjenkinspythonPHP
10d

Sitecore Developer, Remote

CoreTechs Inc.1020 Kifer Rd, Sunnyvale, CA 94086, USA, Remote
4 years of experienceDesignsassuihtml5apic++jenkinsAWSjavascriptbackendNode.js
10d

Senior AWS DevOps Engineer

Version 1Remote, United Kingdom, United Kingdom, Remote
terraformoracleansiblescrumjava.netjenkinspythonAWS
10d

Sr Java SDET - 100% Remote

Klap6TX-16, San Antonio, TX, USA, Remote
agileuiqajavajenkins
10d

DevOps Engineer

nCloudsKyiv, Kyiv, Kyiv, Ukraine, Remote
10d

DevOps Engineer

nCloudsKarachi, Karachi, Sindh, Pakistan, Remote

Jobs featured in previous email 06 April

17d

Vehicle Computer-High performance ADAS Domain Controller - DevOps- Cx development 2021

Bosch GroupAdugodi Main Rd, AK Colony, Adugodi, Bengaluru, Karnataka, India, Remote
agileDesigngitdockerlinuxjenkinspython
17d

Senior Cloud Operations Engineer

ActiveVideoPosition is remote friendly, Englewood, CO, United States, Remote
ansibleqadockerkuberneteslinuxjenkinspythonAWS
17d

Cloud Operations Engineer

ActiveVideoPosition is remote friendly, Columbia, OH, United States, Remote
ansibleqadockerkuberneteslinuxjenkinspythonAWS
18d

Senior DevOps Engineer

Lark ITSpeer Blvd, Denver, CO, USA, Remote
agile3 years of experiencejiraterraformnosqlpostgressqlDesignansibleazurescrumgitrubyjavac++openstackdockerelasticsearchmysqltypescriptcsskuberneteslinuxangularjenkinspythonAWSjavascript
18d

Senior Technical Lead

agilejiraterraformoracleDesignmobileansiblemongodbuihtml5scrumapiqajavac++.netangularjenkinspythonAWSjavascript

Other Job subscriptions you might be insterested in